Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 2971780..2972474 | Replicon | chromosome |
Accession | NZ_LT601384 | ||
Organism | Escherichia coli isolate NCTC86EC |
Toxin (Protein)
Gene name | yafO | Uniprot ID | A0A3P5GWS5 |
Locus tag | NCTC86EC_RS14630 | Protein ID | WP_001263488.1 |
Coordinates | 2971780..2972178 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | NCTC86EC_RS14635 | Protein ID | WP_000554758.1 |
Coordinates | 2972181..2972474 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- | 2967368..2967448 | - | 81 | NuclAT_12 | - | - |
- | 2967368..2967448 | - | 81 | NuclAT_12 | - | - |
- | 2967368..2967448 | - | 81 | NuclAT_12 | - | - |
- | 2967368..2967448 | - | 81 | NuclAT_12 | - | - |
NCTC86EC_RS14605 | 2968044..2968502 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
NCTC86EC_RS14610 | 2968763..2970220 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
NCTC86EC_RS14615 | 2970277..2970798 | - | 522 | Protein_2797 | peptide chain release factor H | - |
NCTC86EC_RS14620 | 2970794..2971000 | - | 207 | Protein_2798 | RtcB family protein | - |
NCTC86EC_RS14625 | 2971318..2971770 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
NCTC86EC_RS14630 | 2971780..2972178 | - | 399 | WP_001263488.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
NCTC86EC_RS14635 | 2972181..2972474 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NCTC86EC_RS14640 | 2972526..2973581 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
NCTC86EC_RS14645 | 2973652..2974437 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
NCTC86EC_RS14650 | 2974409..2976121 | + | 1713 | Protein_2804 | flagellar biosynthesis protein FlhA | - |
NCTC86EC_RS14655 | 2976345..2976842 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 2971780..2987061 | 15281 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15559.90 Da Isoelectric Point: 6.9798
>T293272 WP_001263488.1 NZ_LT601384:c2972178-2971780 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQEAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQEAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3P5GWS5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |