Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2269594..2269857 | Replicon | chromosome |
| Accession | NZ_LT598688 | ||
| Organism | Staphylococcus aureus isolate Sa_Newman_UoM | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | BN8422_RS11850 | Protein ID | WP_001802298.1 |
| Coordinates | 2269753..2269857 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 2269594..2269758 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN8422_RS11830 | 2265843..2266508 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| BN8422_RS11835 | 2266660..2266980 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| BN8422_RS11840 | 2266982..2267962 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| BN8422_RS11845 | 2268228..2269319 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 2269594..2269758 | + | 165 | - | - | Antitoxin |
| BN8422_RS11850 | 2269753..2269857 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| BN8422_RS15735 | 2270018..2270501 | - | 484 | Protein_2249 | recombinase family protein | - |
| BN8422_RS11860 | 2270544..2271680 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| BN8422_RS11865 | 2271969..2272061 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| BN8422_RS11870 | 2272766..2273623 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
| BN8422_RS11875 | 2273691..2274473 | - | 783 | WP_000908177.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T293253 WP_001802298.1 NZ_LT598688:c2269857-2269753 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT293253 NZ_LT598688:2269594-2269758 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|