Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 2536480..2537723 | Replicon | chromosome |
Accession | NZ_LT598657 | ||
Organism | Legionella pneumophila strain Lpm7613 isolate Lpm7613 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | Q5ZSZ6 |
Locus tag | LPM7613_RS11170 | Protein ID | WP_010948074.1 |
Coordinates | 2536785..2537723 (+) | Length | 313 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | Q5ZSZ7 |
Locus tag | LPM7613_RS11165 | Protein ID | WP_010948073.1 |
Coordinates | 2536480..2536788 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPM7613_RS11140 | 2531916..2532281 | + | 366 | WP_010948069.1 | BRCT domain-containing protein | - |
LPM7613_RS11145 | 2532638..2533003 | - | 366 | WP_010948070.1 | TraK family protein | - |
LPM7613_RS15640 | 2533188..2533328 | - | 141 | WP_153802426.1 | hypothetical protein | - |
LPM7613_RS11150 | 2533331..2535082 | - | 1752 | WP_010948071.1 | DUF927 domain-containing protein | - |
LPM7613_RS11155 | 2535148..2535423 | - | 276 | WP_010948072.1 | helix-turn-helix domain-containing protein | - |
LPM7613_RS11160 | 2536256..2536483 | + | 228 | WP_006870829.1 | helix-turn-helix transcriptional regulator | - |
LPM7613_RS11165 | 2536480..2536788 | + | 309 | WP_010948073.1 | HipA N-terminal domain-containing protein | Antitoxin |
LPM7613_RS11170 | 2536785..2537723 | + | 939 | WP_010948074.1 | lpg2370 family Dot/Icm T4SS effector | Toxin |
LPM7613_RS11175 | 2538266..2538880 | + | 615 | WP_010948075.1 | hypothetical protein | - |
LPM7613_RS11180 | 2539036..2539242 | - | 207 | WP_015444115.1 | hypothetical protein | - |
LPM7613_RS11185 | 2539579..2540847 | + | 1269 | WP_010948076.1 | lpg2372 family Dot/Icm T4SS effector | - |
LPM7613_RS11190 | 2541063..2541588 | - | 526 | Protein_2186 | hypothetical protein | - |
LPM7613_RS11195 | 2541588..2542253 | - | 666 | WP_015444114.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 313 a.a. Molecular weight: 36077.81 Da Isoelectric Point: 8.6882
>T293238 WP_010948074.1 NZ_LT598657:2536785-2537723 [Legionella pneumophila]
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
Download Length: 939 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|