Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2607..3258 | Replicon | plasmid 2 |
| Accession | NZ_LT594096 | ||
| Organism | Acinetobacter baumannii strain BAL062 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | N8YFZ1 |
| Locus tag | BAL062_RS19565 | Protein ID | WP_000269904.1 |
| Coordinates | 2607..2963 (+) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | BAL062_RS19570 | Protein ID | WP_001129974.1 |
| Coordinates | 2956..3258 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAL062_RS19550 | 1..936 | + | 936 | WP_001292329.1 | replication initiation protein RepM | - |
| BAL062_RS19555 | 1014..1532 | + | 519 | WP_000839337.1 | plasmid replication DNA-binding protein | - |
| BAL062_RS19560 | 1742..2041 | + | 300 | WP_000358348.1 | hypothetical protein | - |
| BAL062_RS19565 | 2607..2963 | + | 357 | WP_000269904.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BAL062_RS19570 | 2956..3258 | + | 303 | WP_001129974.1 | XRE family transcriptional regulator | Antitoxin |
| BAL062_RS19575 | 3251..3460 | + | 210 | WP_000069474.1 | hypothetical protein | - |
| BAL062_RS19580 | 3786..4247 | - | 462 | WP_000761346.1 | DIP1984 family protein | - |
| BAL062_RS19585 | 4552..5112 | - | 561 | Protein_7 | TonB-dependent receptor | - |
| BAL062_RS19590 | 5162..5923 | - | 762 | WP_000425105.1 | hypothetical protein | - |
| BAL062_RS19595 | 6228..7397 | + | 1170 | WP_002134206.1 | MobA/MobL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..8015 | 8015 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13488.42 Da Isoelectric Point: 5.7104
>T293211 WP_000269904.1 NZ_LT594096:2607-2963 [Acinetobacter baumannii]
MWTVITTDLFNEWLEQQDEATQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKSNKKRFYTEMLAIADEQYALHLSTLGDQSNG
MWTVITTDLFNEWLEQQDEATQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKSNKKRFYTEMLAIADEQYALHLSTLGDQSNG
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|