Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3791418..3791980 | Replicon | chromosome |
| Accession | NZ_LT556085 | ||
| Organism | Citrobacter amalonaticus strain 92 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A8B3ZQU4 |
| Locus tag | CITRO92_RS18790 | Protein ID | WP_044267611.1 |
| Coordinates | 3791418..3791696 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | CITRO92_RS18795 | Protein ID | WP_043000693.1 |
| Coordinates | 3791696..3791980 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CITRO92_RS18770 | 3786543..3786974 | - | 432 | WP_043000697.1 | peroxiredoxin OsmC | - |
| CITRO92_RS18775 | 3787202..3787345 | + | 144 | WP_042319017.1 | stationary-phase-induced ribosome-associated protein | - |
| CITRO92_RS18780 | 3787517..3789214 | + | 1698 | WP_044257943.1 | malate dehydrogenase | - |
| CITRO92_RS18785 | 3789523..3791238 | + | 1716 | WP_109740239.1 | ATP-binding cassette domain-containing protein | - |
| CITRO92_RS18790 | 3791418..3791696 | + | 279 | WP_044267611.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CITRO92_RS18795 | 3791696..3791980 | + | 285 | WP_043000693.1 | HigA family addiction module antidote protein | Antitoxin |
| CITRO92_RS18800 | 3792025..3792627 | - | 603 | WP_109740240.1 | inorganic diphosphatase | - |
| CITRO92_RS18805 | 3792754..3793410 | - | 657 | WP_043000691.1 | formate dehydrogenase-N subunit gamma | - |
| CITRO92_RS18810 | 3793403..3794287 | - | 885 | WP_043000690.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10507.00 Da Isoelectric Point: 8.1206
>T293155 WP_044267611.1 NZ_LT556085:3791418-3791696 [Citrobacter amalonaticus]
MIINFRHKGLRDLFLHGKTSGVLAKHVKRLRHRLAVIDAAGCVNDINMPGYRLHPLSGDRDGVWSISVSGNWRMTFEFVN
GDAYILDDEDYH
MIINFRHKGLRDLFLHGKTSGVLAKHVKRLRHRLAVIDAAGCVNDINMPGYRLHPLSGDRDGVWSISVSGNWRMTFEFVN
GDAYILDDEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|