Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 665870..666686 | Replicon | chromosome |
| Accession | NZ_LT556085 | ||
| Organism | Citrobacter amalonaticus strain 92 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | CITRO92_RS03275 | Protein ID | WP_109739561.1 |
| Coordinates | 665870..666346 (-) | Length | 159 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A3Q8DNJ3 |
| Locus tag | CITRO92_RS03280 | Protein ID | WP_042999108.1 |
| Coordinates | 666351..666686 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CITRO92_RS03255 | 660975..661718 | - | 744 | WP_044264050.1 | molecular chaperone | - |
| CITRO92_RS03260 | 661761..664235 | - | 2475 | WP_044257386.1 | fimbria/pilus outer membrane usher protein | - |
| CITRO92_RS03265 | 664299..664748 | - | 450 | WP_086513030.1 | type 1 fimbrial protein | - |
| CITRO92_RS03270 | 664916..665446 | - | 531 | WP_042999110.1 | type 1 fimbrial protein | - |
| CITRO92_RS03275 | 665870..666346 | - | 477 | WP_109739561.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| CITRO92_RS03280 | 666351..666686 | - | 336 | WP_042999108.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| CITRO92_RS03285 | 666901..667437 | - | 537 | WP_042999107.1 | ferredoxin-type protein NapF | - |
| CITRO92_RS03290 | 667434..668030 | - | 597 | WP_042999106.1 | molecular chaperone | - |
| CITRO92_RS03295 | 668075..668848 | - | 774 | WP_044327723.1 | dimethyl sulfoxide reductase anchor subunit | - |
| CITRO92_RS03300 | 668841..669467 | - | 627 | WP_109739562.1 | dimethylsulfoxide reductase subunit B | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 18170.78 Da Isoelectric Point: 8.2616
>T293148 WP_109739561.1 NZ_LT556085:c666346-665870 [Citrobacter amalonaticus]
MDFPTWLNGWTIYAHPCFIDQYNALVARVEDLKHRFPDPIVFQKKKETMVLAHLLKSIANITHEPRASVYRPGDSIGKAY
TDWSRAKFGGGRYRLFFRYSLESKIIVIAWVNDEGSLRTCGSKTDAYKIFGKMLDEGNPPDDWLSLLQACQNDGKEHL
MDFPTWLNGWTIYAHPCFIDQYNALVARVEDLKHRFPDPIVFQKKKETMVLAHLLKSIANITHEPRASVYRPGDSIGKAY
TDWSRAKFGGGRYRLFFRYSLESKIIVIAWVNDEGSLRTCGSKTDAYKIFGKMLDEGNPPDDWLSLLQACQNDGKEHL
Download Length: 477 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|