Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3136983..3137545 | Replicon | chromosome |
| Accession | NZ_LT556084 | ||
| Organism | Citrobacter amalonaticus strain 86 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A8B3ZQU4 |
| Locus tag | CITRO86_RS15660 | Protein ID | WP_044267611.1 |
| Coordinates | 3137267..3137545 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | CITRO86_RS15655 | Protein ID | WP_043000693.1 |
| Coordinates | 3136983..3137267 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CITRO86_RS15640 | 3134676..3135560 | + | 885 | WP_043000690.1 | formate dehydrogenase subunit beta | - |
| CITRO86_RS15645 | 3135553..3136209 | + | 657 | WP_043000691.1 | formate dehydrogenase-N subunit gamma | - |
| CITRO86_RS15650 | 3136336..3136938 | + | 603 | WP_109740240.1 | inorganic diphosphatase | - |
| CITRO86_RS15655 | 3136983..3137267 | - | 285 | WP_043000693.1 | HigA family addiction module antidote protein | Antitoxin |
| CITRO86_RS15660 | 3137267..3137545 | - | 279 | WP_044267611.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CITRO86_RS15665 | 3137725..3139440 | - | 1716 | WP_109740239.1 | ATP-binding cassette domain-containing protein | - |
| CITRO86_RS15670 | 3139749..3141446 | - | 1698 | WP_044257943.1 | malate dehydrogenase | - |
| CITRO86_RS15675 | 3141618..3141761 | - | 144 | WP_042319017.1 | stationary-phase-induced ribosome-associated protein | - |
| CITRO86_RS15680 | 3141989..3142420 | + | 432 | WP_043000697.1 | peroxiredoxin OsmC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10507.00 Da Isoelectric Point: 8.1206
>T293140 WP_044267611.1 NZ_LT556084:c3137545-3137267 [Citrobacter amalonaticus]
MIINFRHKGLRDLFLHGKTSGVLAKHVKRLRHRLAVIDAAGCVNDINMPGYRLHPLSGDRDGVWSISVSGNWRMTFEFVN
GDAYILDDEDYH
MIINFRHKGLRDLFLHGKTSGVLAKHVKRLRHRLAVIDAAGCVNDINMPGYRLHPLSGDRDGVWSISVSGNWRMTFEFVN
GDAYILDDEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|