Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 1147191..1148007 | Replicon | chromosome |
| Accession | NZ_LT556084 | ||
| Organism | Citrobacter amalonaticus strain 86 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | CITRO86_RS05590 | Protein ID | WP_109739561.1 |
| Coordinates | 1147531..1148007 (+) | Length | 159 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A3Q8DNJ3 |
| Locus tag | CITRO86_RS05585 | Protein ID | WP_042999108.1 |
| Coordinates | 1147191..1147526 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CITRO86_RS05565 | 1144410..1145036 | + | 627 | WP_109739562.1 | dimethylsulfoxide reductase subunit B | - |
| CITRO86_RS05570 | 1145029..1145802 | + | 774 | WP_044327723.1 | dimethyl sulfoxide reductase anchor subunit | - |
| CITRO86_RS05575 | 1145847..1146443 | + | 597 | WP_042999106.1 | molecular chaperone | - |
| CITRO86_RS05580 | 1146440..1146976 | + | 537 | WP_042999107.1 | ferredoxin-type protein NapF | - |
| CITRO86_RS05585 | 1147191..1147526 | + | 336 | WP_042999108.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| CITRO86_RS05590 | 1147531..1148007 | + | 477 | WP_109739561.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| CITRO86_RS05595 | 1148431..1148961 | + | 531 | WP_042999110.1 | type 1 fimbrial protein | - |
| CITRO86_RS05600 | 1149129..1149578 | + | 450 | WP_086513030.1 | type 1 fimbrial protein | - |
| CITRO86_RS05605 | 1149642..1152116 | + | 2475 | WP_044257386.1 | fimbria/pilus outer membrane usher protein | - |
| CITRO86_RS05610 | 1152159..1152902 | + | 744 | WP_044264050.1 | molecular chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 18170.78 Da Isoelectric Point: 8.2616
>T293133 WP_109739561.1 NZ_LT556084:1147531-1148007 [Citrobacter amalonaticus]
MDFPTWLNGWTIYAHPCFIDQYNALVARVEDLKHRFPDPIVFQKKKETMVLAHLLKSIANITHEPRASVYRPGDSIGKAY
TDWSRAKFGGGRYRLFFRYSLESKIIVIAWVNDEGSLRTCGSKTDAYKIFGKMLDEGNPPDDWLSLLQACQNDGKEHL
MDFPTWLNGWTIYAHPCFIDQYNALVARVEDLKHRFPDPIVFQKKKETMVLAHLLKSIANITHEPRASVYRPGDSIGKAY
TDWSRAKFGGGRYRLFFRYSLESKIIVIAWVNDEGSLRTCGSKTDAYKIFGKMLDEGNPPDDWLSLLQACQNDGKEHL
Download Length: 477 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|