Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 1147191..1148007 | Replicon | chromosome |
Accession | NZ_LT556084 | ||
Organism | Citrobacter amalonaticus strain 86 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | CITRO86_RS05590 | Protein ID | WP_109739561.1 |
Coordinates | 1147531..1148007 (+) | Length | 159 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | A0A3Q8DNJ3 |
Locus tag | CITRO86_RS05585 | Protein ID | WP_042999108.1 |
Coordinates | 1147191..1147526 (+) | Length | 112 a.a. |
Genomic Context
Location: 1144410..1145036 (627 bp)
Type: Others
Protein ID: WP_109739562.1
Type: Others
Protein ID: WP_109739562.1
Location: 1145029..1145802 (774 bp)
Type: Others
Protein ID: WP_044327723.1
Type: Others
Protein ID: WP_044327723.1
Location: 1145847..1146443 (597 bp)
Type: Others
Protein ID: WP_042999106.1
Type: Others
Protein ID: WP_042999106.1
Location: 1146440..1146976 (537 bp)
Type: Others
Protein ID: WP_042999107.1
Type: Others
Protein ID: WP_042999107.1
Location: 1147191..1147526 (336 bp)
Type: Antitoxin
Protein ID: WP_042999108.1
Type: Antitoxin
Protein ID: WP_042999108.1
Location: 1147531..1148007 (477 bp)
Type: Toxin
Protein ID: WP_109739561.1
Type: Toxin
Protein ID: WP_109739561.1
Location: 1148431..1148961 (531 bp)
Type: Others
Protein ID: WP_042999110.1
Type: Others
Protein ID: WP_042999110.1
Location: 1149129..1149578 (450 bp)
Type: Others
Protein ID: WP_086513030.1
Type: Others
Protein ID: WP_086513030.1
Location: 1149642..1152116 (2475 bp)
Type: Others
Protein ID: WP_044257386.1
Type: Others
Protein ID: WP_044257386.1
Location: 1152159..1152902 (744 bp)
Type: Others
Protein ID: WP_044264050.1
Type: Others
Protein ID: WP_044264050.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CITRO86_RS05565 | 1144410..1145036 | + | 627 | WP_109739562.1 | dimethylsulfoxide reductase subunit B | - |
CITRO86_RS05570 | 1145029..1145802 | + | 774 | WP_044327723.1 | dimethyl sulfoxide reductase anchor subunit | - |
CITRO86_RS05575 | 1145847..1146443 | + | 597 | WP_042999106.1 | molecular chaperone | - |
CITRO86_RS05580 | 1146440..1146976 | + | 537 | WP_042999107.1 | ferredoxin-type protein NapF | - |
CITRO86_RS05585 | 1147191..1147526 | + | 336 | WP_042999108.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
CITRO86_RS05590 | 1147531..1148007 | + | 477 | WP_109739561.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
CITRO86_RS05595 | 1148431..1148961 | + | 531 | WP_042999110.1 | type 1 fimbrial protein | - |
CITRO86_RS05600 | 1149129..1149578 | + | 450 | WP_086513030.1 | type 1 fimbrial protein | - |
CITRO86_RS05605 | 1149642..1152116 | + | 2475 | WP_044257386.1 | fimbria/pilus outer membrane usher protein | - |
CITRO86_RS05610 | 1152159..1152902 | + | 744 | WP_044264050.1 | molecular chaperone | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 18170.78 Da Isoelectric Point: 8.2616
>T293133 WP_109739561.1 NZ_LT556084:1147531-1148007 [Citrobacter amalonaticus]
MDFPTWLNGWTIYAHPCFIDQYNALVARVEDLKHRFPDPIVFQKKKETMVLAHLLKSIANITHEPRASVYRPGDSIGKAY
TDWSRAKFGGGRYRLFFRYSLESKIIVIAWVNDEGSLRTCGSKTDAYKIFGKMLDEGNPPDDWLSLLQACQNDGKEHL
MDFPTWLNGWTIYAHPCFIDQYNALVARVEDLKHRFPDPIVFQKKKETMVLAHLLKSIANITHEPRASVYRPGDSIGKAY
TDWSRAKFGGGRYRLFFRYSLESKIIVIAWVNDEGSLRTCGSKTDAYKIFGKMLDEGNPPDDWLSLLQACQNDGKEHL
Download Length: 477 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Q8DNJ3 |