Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 1157128..1157734 Replicon chromosome
Accession NZ_LT549890
Organism Saccharolobus solfataricus strain P1

Toxin (Protein)


Gene name vapC Uniprot ID Q97YS3
Locus tag SSOP1_RS06575 Protein ID WP_009993017.1
Coordinates 1157342..1157734 (+) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A3G8ES43
Locus tag SSOP1_RS06570 Protein ID WP_009993015.1
Coordinates 1157128..1157352 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SSOP1_RS06545 (SSOP1_1335) 1152276..1153406 + 1131 WP_009992604.1 aromatic/alkene monooxygenase hydroxylase subunit beta -
SSOP1_RS06550 (SSOP1_1336) 1153403..1153864 + 462 WP_010923265.1 metal-sulfur cluster assembly factor -
SSOP1_RS06555 1153907..1154876 - 970 Protein_1303 IS110 family transposase -
SSOP1_RS06560 (SSOP1_1339) 1154875..1155858 - 984 WP_010923242.1 IS630-like element ISC1048 family transposase -
SSOP1_RS06565 1155903..1156818 + 916 Protein_1305 IS110 family transposase -
SSOP1_RS06570 (SSOP1_1343) 1157128..1157352 + 225 WP_009993015.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
SSOP1_RS06575 (SSOP1_1344) 1157342..1157734 + 393 WP_009993017.1 type II toxin-antitoxin system VapC family toxin Toxin
SSOP1_RS16290 1158177..1158655 - 479 Protein_1308 ISNCY family transposase -
SSOP1_RS06590 (SSOP1_1348) 1158773..1159825 + 1053 WP_063492773.1 ISH3 family transposase -
SSOP1_RS06595 (SSOP1_1349) 1160013..1160600 - 588 Protein_1310 ISNCY family transposase -
SSOP1_RS06600 (SSOP1_1350) 1161034..1161375 - 342 WP_009990179.1 nucleotidyltransferase domain-containing protein -
SSOP1_RS06605 (SSOP1_1351) 1161366..1161713 - 348 WP_014511635.1 HEPN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside IScluster/Tn - - 1154310..1160600 6290


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Pae0151-like, PIN domain

(8-124)

Antitoxin

Post-segregation antitoxin CcdA

(5-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 15117.81 Da        Isoelectric Point: 9.3474

>T293125 WP_009993017.1 NZ_LT549890:1157342-1157734 [Saccharolobus solfataricus]
MKDKEFLLDASALYSLLDYVDKVDVKKIHVLTLTFYEVGNVIWKEYYIHKKVKDPITLSRLFYKLMRKFNVIEDSPLEGV
MRIAIERGLTYYNASYAYVAESLGLILVSNDKELIRKANAISLKDLIKSM

Download         Length: 393 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8840.20 Da        Isoelectric Point: 5.0190

>AT293125 WP_009993015.1 NZ_LT549890:1157128-1157352 [Saccharolobus solfataricus]
MSDVISVRVKKELKKKAEELGINVREVVEKALEEAIREKEKEELKDMTMKIKELMRDVSEYDWVSTVRESRDER

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E3GVD1

Antitoxin

Source ID Structure
AlphaFold DB A0A3G8ES43

References