Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 2469237..2469759 | Replicon | chromosome |
Accession | NZ_LT220504 | ||
Organism | Lacticaseibacillus rhamnosus strain BPL5 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | C2JUK2 |
Locus tag | BN3853_RS11535 | Protein ID | WP_005687756.1 |
Coordinates | 2469237..2469497 (-) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | C2JUK3 |
Locus tag | BN3853_RS11540 | Protein ID | WP_005687754.1 |
Coordinates | 2469490..2469759 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN3853_RS11510 | 2464653..2465294 | + | 642 | WP_005690763.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
BN3853_RS11515 | 2465362..2466141 | + | 780 | WP_005690765.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
BN3853_RS11520 | 2466326..2467213 | + | 888 | WP_014571690.1 | L-ribulose-5-phosphate 3-epimerase | - |
BN3853_RS11525 | 2467280..2468101 | - | 822 | WP_005690770.1 | Cof-type HAD-IIB family hydrolase | - |
BN3853_RS11530 | 2468298..2469026 | + | 729 | WP_014571689.1 | L-ribulose-5-phosphate 4-epimerase | - |
BN3853_RS11535 | 2469237..2469497 | - | 261 | WP_005687756.1 | Txe/YoeB family addiction module toxin | Toxin |
BN3853_RS11540 | 2469490..2469759 | - | 270 | WP_005687754.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
BN3853_RS11545 | 2470385..2471185 | + | 801 | WP_005690776.1 | SDR family oxidoreductase | - |
BN3853_RS11550 | 2471212..2473080 | + | 1869 | WP_014571687.1 | HTH domain-containing protein | - |
BN3853_RS11555 | 2473081..2473590 | + | 510 | WP_005690780.1 | transcriptional regulator GutM | - |
BN3853_RS11560 | 2473603..2474172 | + | 570 | WP_005687747.1 | PTS glucitol/sorbitol transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10485.91 Da Isoelectric Point: 9.6577
>T293115 WP_005687756.1 NZ_LT220504:c2469497-2469237 [Lacticaseibacillus rhamnosus]
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249N526 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249N594 |