Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2009453..2010042 | Replicon | chromosome |
Accession | NZ_LS999833 | ||
Organism | Lentilitoribacter sp. Alg239-R112 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | G3W54_RS09980 | Protein ID | WP_162652913.1 |
Coordinates | 2009764..2010042 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | G3W54_RS09975 | Protein ID | WP_162652912.1 |
Coordinates | 2009453..2009746 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G3W54_RS09955 | 2005524..2006747 | - | 1224 | WP_162652910.1 | O-antigen ligase family protein | - |
G3W54_RS09960 | 2006968..2008476 | + | 1509 | WP_162652911.1 | GumC family protein | - |
G3W54_RS19195 | 2008661..2008828 | + | 168 | WP_197742819.1 | transposase | - |
G3W54_RS19200 | 2009173..2009292 | + | 120 | Protein_1979 | tyrosine-type recombinase/integrase | - |
G3W54_RS09975 | 2009453..2009746 | - | 294 | WP_162652912.1 | HigA family addiction module antidote protein | Antitoxin |
G3W54_RS09980 | 2009764..2010042 | - | 279 | WP_162652913.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
G3W54_RS09985 | 2010166..2010768 | - | 603 | WP_162653647.1 | histidine phosphatase family protein | - |
G3W54_RS09990 | 2010765..2011823 | - | 1059 | WP_162652914.1 | ABC transporter ATP-binding protein | - |
G3W54_RS09995 | 2011833..2013578 | - | 1746 | WP_162652915.1 | iron ABC transporter permease | - |
G3W54_RS10000 | 2013663..2014784 | - | 1122 | WP_162652916.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2008661..2008828 | 167 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10737.04 Da Isoelectric Point: 5.1356
>T293097 WP_162652913.1 NZ_LS999833:c2010042-2009764 [Lentilitoribacter sp. Alg239-R112]
MIKSYRDKKTSVFANGEFVRIFQGFSRQAEKRLEILDAAEITGDLTVLPSNRFEALSGDRVGQFSIRINQQWHICFEWRD
DGPENVEIVDYH
MIKSYRDKKTSVFANGEFVRIFQGFSRQAEKRLEILDAAEITGDLTVLPSNRFEALSGDRVGQFSIRINQQWHICFEWRD
DGPENVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|