Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 73690..73954 Replicon plasmid 3
Accession NZ_LS999562
Organism Escherichia coli isolate EC-TO143

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag ECTO143_RS26290 Protein ID WP_001331364.1
Coordinates 73802..73954 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 73690..73747 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO143_RS26275 68929..71220 - 2292 WP_001289276.1 hypothetical protein -
ECTO143_RS26280 71213..72283 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
ECTO143_RS26285 72302..73510 - 1209 WP_016245570.1 IncI1-type conjugal transfer protein TrbA -
- 73690..73747 - 58 NuclAT_0 - Antitoxin
- 73690..73747 - 58 NuclAT_0 - Antitoxin
- 73690..73747 - 58 NuclAT_0 - Antitoxin
- 73690..73747 - 58 NuclAT_0 - Antitoxin
ECTO143_RS26290 73802..73954 + 153 WP_001331364.1 Hok/Gef family protein Toxin
ECTO143_RS26295 74026..74277 - 252 WP_032329894.1 hypothetical protein -
ECTO143_RS27085 74936..75112 - 177 WP_001054897.1 hypothetical protein -
ECTO143_RS26300 75504..75713 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
ECTO143_RS26305 75785..76435 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
ECTO143_RS26310 76509..78677 - 2169 WP_000698357.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-1 - 1..102557 102557


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T293092 WP_001331364.1 NZ_LS999562:73802-73954 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT293092 NZ_LS999562:c73747-73690 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References