Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3623723..3624402 | Replicon | chromosome |
| Accession | NZ_LS999560 | ||
| Organism | Escherichia coli isolate EC-TO143 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | ECTO143_RS18155 | Protein ID | WP_000057523.1 |
| Coordinates | 3624100..3624402 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | ECTO143_RS18150 | Protein ID | WP_000806442.1 |
| Coordinates | 3623723..3624064 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO143_RS18140 | 3619967..3620899 | - | 933 | WP_000883041.1 | glutaminase A | - |
| ECTO143_RS18145 | 3621161..3623665 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| ECTO143_RS18150 | 3623723..3624064 | - | 342 | WP_000806442.1 | HigA family addiction module antidote protein | Antitoxin |
| ECTO143_RS18155 | 3624100..3624402 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ECTO143_RS18160 | 3624535..3625329 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| ECTO143_RS18165 | 3625533..3626012 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| ECTO143_RS18170 | 3626036..3626836 | + | 801 | WP_000439798.1 | hypothetical protein | - |
| ECTO143_RS18175 | 3626833..3627336 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| ECTO143_RS18180 | 3627374..3629026 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T293072 WP_000057523.1 NZ_LS999560:c3624402-3624100 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|