Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/- |
| Location | 4457776..4458430 | Replicon | chromosome |
| Accession | NZ_LS999205 | ||
| Organism | Pseudomonas protegens CHA0 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2C9EQ14 |
| Locus tag | PPRCHA0_RS20440 | Protein ID | WP_015636300.1 |
| Coordinates | 4457776..4458126 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | Q4K9S2 |
| Locus tag | PPRCHA0_RS20445 | Protein ID | WP_011062198.1 |
| Coordinates | 4458113..4458430 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPRCHA0_RS20430 | 4454535..4456067 | + | 1533 | WP_015636298.1 | NADH-quinone oxidoreductase subunit M | - |
| PPRCHA0_RS20435 | 4456075..4457538 | + | 1464 | WP_015636299.1 | NADH-quinone oxidoreductase subunit NuoN | - |
| PPRCHA0_RS20440 | 4457776..4458126 | + | 351 | WP_015636300.1 | hypothetical protein | Toxin |
| PPRCHA0_RS20445 | 4458113..4458430 | + | 318 | WP_011062198.1 | transcriptional regulator | Antitoxin |
| PPRCHA0_RS20450 | 4458503..4459885 | - | 1383 | WP_015636301.1 | cysteine--tRNA ligase | - |
| PPRCHA0_RS20455 | 4459904..4461604 | - | 1701 | WP_015636302.1 | glutamine--tRNA ligase/YqeY domain fusion protein | - |
| PPRCHA0_RS20460 | 4461875..4462378 | + | 504 | WP_011062201.1 | peptidyl-prolyl cis-trans isomerase | - |
| PPRCHA0_RS20465 | 4462375..4463127 | + | 753 | WP_015636303.1 | UDP-2,3-diacylglucosamine diphosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 14008.14 Da Isoelectric Point: 8.9805
>T293040 WP_015636300.1 NZ_LS999205:4457776-4458126 [Pseudomonas protegens CHA0]
MNALFIELPAFARYRKGFLDDELFCELQIELLRHPHAGVLIQGTGGLRKMRFIDERRNKGRRGGLRVIYYWWSEGAQFWL
FTLFDKEQMDDLLPQQRQQLKQLLEREIEARRHDQT
MNALFIELPAFARYRKGFLDDELFCELQIELLRHPHAGVLIQGTGGLRKMRFIDERRNKGRRGGLRVIYYWWSEGAQFWL
FTLFDKEQMDDLLPQQRQQLKQLLEREIEARRHDQT
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2C9EQ14 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2C9EPZ9 |