Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 100805..101038 | Replicon | plasmid 2 |
| Accession | NZ_LS998786 | ||
| Organism | Escherichia coli isolate EC-TO75 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | ECTO75_RS23840 | Protein ID | WP_001312861.1 |
| Coordinates | 100880..101038 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 100805..100836 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO75_RS23810 | 96927..97424 | + | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
| ECTO75_RS23815 | 97492..97725 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| ECTO75_RS23820 | 97753..97950 | + | 198 | Protein_117 | hypothetical protein | - |
| ECTO75_RS23825 | 98005..98439 | + | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| ECTO75_RS23830 | 98436..99155 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| ECTO75_RS24355 | 99167..99355 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 99167..99364 | + | 198 | NuclAT_1 | - | - |
| - | 99167..99364 | + | 198 | NuclAT_1 | - | - |
| - | 99167..99364 | + | 198 | NuclAT_1 | - | - |
| - | 99167..99364 | + | 198 | NuclAT_1 | - | - |
| ECTO75_RS23835 | 99412..100780 | + | 1369 | Protein_121 | IS3-like element IS150 family transposase | - |
| - | 100805..100836 | + | 32 | NuclAT_3 | - | Antitoxin |
| - | 100805..100836 | + | 32 | NuclAT_3 | - | Antitoxin |
| - | 100805..100836 | + | 32 | NuclAT_3 | - | Antitoxin |
| - | 100805..100836 | + | 32 | NuclAT_3 | - | Antitoxin |
| ECTO75_RS23840 | 100880..101038 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| ECTO75_RS23855 | 101959..102247 | + | 289 | Protein_123 | hypothetical protein | - |
| ECTO75_RS23860 | 102365..103188 | + | 824 | Protein_124 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | sitABCD | iucA / iucB / iucC / iucD / iutA | 1..103198 | 103198 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T293035 WP_001312861.1 NZ_LS998786:100880-101038 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 32 bp
>AT293035 NZ_LS998786:100805-100836 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|