Detailed information of TA system TA293029

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 21602..21856
• Replicon: plasmid 2
• Accession: NZ_LS998786
• Organism: Escherichia coli isolate EC-TO75

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: ECTO75_RS23305
• Protein ID: WP_015387399.1
• Coordinates: 21650..21856 (+)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	21602..21663 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ECTO75_RS23260	17254..17466	+	213	WP_005012601.1	hypothetical protein	-
ECTO75_RS24450	17767..17856	-	90	Protein_24	IS1 family transposase	-
ECTO75_RS23275	17911..18588	+	678	WP_001339397.1	IS66 family insertion sequence hypothetical protein	-
ECTO75_RS23280	18588..18935	+	348	WP_000624622.1	IS66 family insertion sequence element accessory protein TnpB	-
ECTO75_RS23285	18955..20526	+	1572	WP_023149734.1	IS66 family transposase	-
ECTO75_RS23290	20564..21180	-	617	Protein_28	IS1 family transposase	-
ECTO75_RS23295	21281..21463	+	183	WP_000968309.1	hypothetical protein	-
-	21602..21663	-	62	NuclAT_4	-	Antitoxin
-	21602..21663	-	62	NuclAT_4	-	Antitoxin
-	21602..21663	-	62	NuclAT_4	-	Antitoxin
-	21602..21663	-	62	NuclAT_4	-	Antitoxin
ECTO75_RS23305	21650..21856	+	207	WP_015387399.1	type I toxin-antitoxin system Hok family toxin	Toxin
ECTO75_RS23310	22140..22397	+	258	WP_000083833.1	replication regulatory protein RepA	-
ECTO75_RS23320	22633..22707	+	75	WP_032336874.1	RepA leader peptide Tap	-
ECTO75_RS23325	22700..23146	+	447	Protein_33	incFII family plasmid replication initiator RepA	-
ECTO75_RS23330	23092..23574	-	483	Protein_34	VENN motif pre-toxin domain-containing protein	-
ECTO75_RS23335	24467..25687	+	1221	WP_000410951.1	arginine deiminase	-
ECTO75_RS23340	25698..26609	+	912	WP_000440183.1	carbamate kinase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	sitABCD	iucA / iucB / iucC / iucD / iutA	1..103198	103198

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7720.23 Da
• Isoelectric Point: 9.3127

>T293029 WP_015387399.1 NZ_LS998786:21650-21856 [Escherichia coli]
MKYLNTTDCSLFLAGRSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

Antitoxin

Nucleotide

• Length: 62 bp

>AT293029 NZ_LS998786:c21663-21602 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin