Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 5991..6224 | Replicon | plasmid 2 |
| Accession | NZ_LS998786 | ||
| Organism | Escherichia coli isolate EC-TO75 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | ECTO75_RS23175 | Protein ID | WP_001312861.1 |
| Coordinates | 6066..6224 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 5991..6022 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO75_RS23145 | 2112..2609 | + | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
| ECTO75_RS23150 | 2677..2910 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| ECTO75_RS23155 | 2938..3135 | + | 198 | Protein_3 | hypothetical protein | - |
| ECTO75_RS23160 | 3190..3624 | + | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| ECTO75_RS23165 | 3621..4340 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| ECTO75_RS24345 | 4352..4540 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 4352..4549 | + | 198 | NuclAT_0 | - | - |
| - | 4352..4549 | + | 198 | NuclAT_0 | - | - |
| - | 4352..4549 | + | 198 | NuclAT_0 | - | - |
| - | 4352..4549 | + | 198 | NuclAT_0 | - | - |
| ECTO75_RS23170 | 4597..5966 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - | 5991..6022 | + | 32 | NuclAT_2 | - | Antitoxin |
| - | 5991..6022 | + | 32 | NuclAT_2 | - | Antitoxin |
| - | 5991..6022 | + | 32 | NuclAT_2 | - | Antitoxin |
| - | 5991..6022 | + | 32 | NuclAT_2 | - | Antitoxin |
| ECTO75_RS23175 | 6066..6224 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| ECTO75_RS23190 | 7145..7432 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| ECTO75_RS23195 | 7550..8371 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
| ECTO75_RS23200 | 8668..9270 | - | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| ECTO75_RS23205 | 9591..9974 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| ECTO75_RS23210 | 10161..10850 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | sitABCD | iucA / iucB / iucC / iucD / iutA | 1..103198 | 103198 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T293025 WP_001312861.1 NZ_LS998786:6066-6224 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 32 bp
>AT293025 NZ_LS998786:5991-6022 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
