Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 777593..778286 | Replicon | chromosome |
| Accession | NZ_LS998785 | ||
| Organism | Escherichia coli isolate EC-TO75 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | U9ZN09 |
| Locus tag | ECTO75_RS03805 | Protein ID | WP_000415585.1 |
| Coordinates | 777593..777889 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | ECTO75_RS03810 | Protein ID | WP_000650107.1 |
| Coordinates | 777891..778286 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO75_RS03775 | 772727..773919 | + | 1193 | Protein_726 | Hcp family type VI secretion system effector | - |
| ECTO75_RS03780 | 773926..774258 | + | 333 | WP_000914690.1 | DUF2645 family protein | - |
| ECTO75_RS03785 | 774304..775653 | - | 1350 | WP_000673358.1 | two-component system sensor histidine kinase QseC | - |
| ECTO75_RS03790 | 775650..776309 | - | 660 | WP_001221502.1 | two-component system response regulator QseB | - |
| ECTO75_RS03795 | 776461..776853 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| ECTO75_RS03800 | 776906..777388 | + | 483 | WP_000183505.1 | transcriptional regulator | - |
| ECTO75_RS03805 | 777593..777889 | + | 297 | WP_000415585.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| ECTO75_RS03810 | 777891..778286 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| ECTO75_RS03815 | 778419..780026 | + | 1608 | WP_001375094.1 | ABC transporter substrate-binding protein | - |
| ECTO75_RS03820 | 780164..782422 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11261.99 Da Isoelectric Point: 8.9070
>T293010 WP_000415585.1 NZ_LS998785:777593-777889 [Escherichia coli]
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT293010 WP_000650107.1 NZ_LS998785:777891-778286 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|