Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 6096993..6097588 | Replicon | chromosome |
Accession | NZ_LS998783 | ||
Organism | Pseudomonas aeruginosa isolate |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PA5486_RS29965 | Protein ID | WP_003117425.1 |
Coordinates | 6097310..6097588 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PA5486_RS29960 | Protein ID | WP_003099268.1 |
Coordinates | 6096993..6097298 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PA5486_RS29925 | 6093636..6093911 | - | 276 | WP_033896065.1 | mercury resistance system periplasmic binding protein MerP | - |
PA5486_RS29930 | 6093927..6094277 | - | 351 | WP_001294660.1 | mercuric transport protein MerT | - |
PA5486_RS29935 | 6094349..6094804 | + | 456 | WP_033896066.1 | Hg(II)-responsive transcriptional regulator | - |
PA5486_RS29940 | 6095166..6095942 | - | 777 | WP_033896079.1 | hypothetical protein | - |
PA5486_RS29945 | 6095967..6096080 | - | 114 | Protein_5760 | RepA | - |
PA5486_RS29950 | 6096119..6096331 | - | 213 | WP_025297679.1 | AlpA family phage regulatory protein | - |
PA5486_RS29960 | 6096993..6097298 | - | 306 | WP_003099268.1 | HigA family addiction module antidote protein | Antitoxin |
PA5486_RS29965 | 6097310..6097588 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PA5486_RS29975 | 6097913..6100141 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PA5486_RS29980 | 6100211..6100858 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PA5486_RS29985 | 6100920..6102158 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T293007 WP_003117425.1 NZ_LS998783:c6097588-6097310 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|