Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 32494..32747 | Replicon | plasmid 3 |
| Accession | NZ_LS992194 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO217 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | ECTO217_RS27920 | Protein ID | WP_001312851.1 |
| Coordinates | 32494..32643 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 32688..32747 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO217_RS27875 | 27838..28320 | - | 483 | WP_001311056.1 | hypothetical protein | - |
| ECTO217_RS27880 | 28437..29285 | - | 849 | WP_049144635.1 | 3'-5' exonuclease | - |
| ECTO217_RS27885 | 29331..29612 | - | 282 | WP_047628495.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ECTO217_RS27890 | 29609..29878 | - | 270 | WP_049144636.1 | hypothetical protein | - |
| ECTO217_RS27900 | 30792..31649 | - | 858 | WP_016240488.1 | incFII family plasmid replication initiator RepA | - |
| ECTO217_RS27905 | 31642..31716 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| ECTO217_RS27915 | 31961..32209 | - | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
| ECTO217_RS27920 | 32494..32643 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 32688..32747 | + | 60 | NuclAT_2 | - | Antitoxin |
| - | 32688..32747 | + | 60 | NuclAT_2 | - | Antitoxin |
| - | 32688..32747 | + | 60 | NuclAT_2 | - | Antitoxin |
| - | 32688..32747 | + | 60 | NuclAT_2 | - | Antitoxin |
| ECTO217_RS27930 | 32890..33363 | - | 474 | WP_016240489.1 | hypothetical protein | - |
| ECTO217_RS27935 | 33518..34108 | - | 591 | WP_049144557.1 | DUF2726 domain-containing protein | - |
| ECTO217_RS27940 | 34146..34355 | - | 210 | WP_049144558.1 | hemolysin expression modulator Hha | - |
| ECTO217_RS27945 | 34401..34862 | - | 462 | WP_032283779.1 | thermonuclease family protein | - |
| ECTO217_RS27950 | 35109..35321 | - | 213 | WP_001301409.1 | ANR family transcriptional regulator | - |
| ECTO217_RS27955 | 35453..36013 | - | 561 | WP_011666502.1 | fertility inhibition protein FinO | - |
| ECTO217_RS27960 | 36068..36814 | - | 747 | WP_032283778.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..86367 | 86367 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T292976 WP_001312851.1 NZ_LS992194:c32643-32494 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT292976 NZ_LS992194:32688-32747 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|