Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2551..2971 | Replicon | plasmid 3 |
| Accession | NZ_LS992194 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO217 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | ECTO217_RS27680 | Protein ID | WP_134163217.1 |
| Coordinates | 2551..2706 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 2750..2971 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO217_RS27635 | 1..109 | + | 109 | Protein_0 | lytic transglycosylase | - |
| ECTO217_RS28425 | 408..1223 | - | 816 | Protein_1 | DUF932 domain-containing protein | - |
| ECTO217_RS27655 | 1352..1647 | - | 296 | Protein_2 | hypothetical protein | - |
| ECTO217_RS27675 | 2131..2309 | + | 179 | Protein_3 | pilus assembly protein | - |
| ECTO217_RS27680 | 2551..2706 | - | 156 | WP_134163217.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 2750..2971 | + | 222 | - | - | Antitoxin |
| - | 2750..2974 | - | 225 | NuclAT_1 | - | - |
| - | 2750..2974 | - | 225 | NuclAT_1 | - | - |
| - | 2750..2974 | - | 225 | NuclAT_1 | - | - |
| - | 2750..2974 | - | 225 | NuclAT_1 | - | - |
| ECTO217_RS27690 | 2943..3711 | - | 769 | Protein_6 | plasmid SOS inhibition protein A | - |
| ECTO217_RS27700 | 3708..4145 | - | 438 | Protein_7 | conjugation system SOS inhibitor PsiB | - |
| ECTO217_RS27705 | 4214..6179 | - | 1966 | Protein_8 | ParB/RepB/Spo0J family partition protein | - |
| ECTO217_RS27710 | 6240..6473 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| ECTO217_RS27715 | 6531..7016 | - | 486 | WP_031311812.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..86367 | 86367 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 6056.41 Da Isoelectric Point: 10.4375
>T292971 WP_134163217.1 NZ_LS992194:c2706-2551 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMALRIR
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMALRIR
Download Length: 156 bp
Antitoxin
Download Length: 222 bp
>AT292971 NZ_LS992194:2750-2971 [Escherichia coli]
ATGTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTTTCTGCCACACA
ACACGGTAACAAACCACCTTCACGTCATGAGGCAGAAAGCCTCAAGCGCCGGGCACATCATAGCCCATATACCTGCACGC
TGACCACACTCACTTTTCCTGAAAATAACCCGCTCATTCAGGCTGTTTACGGGTAATCTGTG
ATGTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTTTCTGCCACACA
ACACGGTAACAAACCACCTTCACGTCATGAGGCAGAAAGCCTCAAGCGCCGGGCACATCATAGCCCATATACCTGCACGC
TGACCACACTCACTTTTCCTGAAAATAACCCGCTCATTCAGGCTGTTTACGGGTAATCTGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|