Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 76683..76916 | Replicon | plasmid 2 |
Accession | NZ_LS992193 | ||
Organism | Escherichia coli isolate Escherichia coli str. TO217 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | ECTO217_RS27270 | Protein ID | WP_001312861.1 |
Coordinates | 76683..76841 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 76885..76916 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECTO217_RS27235 | 72057..72746 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
ECTO217_RS27240 | 72933..73316 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
ECTO217_RS27245 | 73637..74239 | + | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
ECTO217_RS27250 | 74536..75357 | - | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
ECTO217_RS27255 | 75475..75762 | - | 288 | WP_000107535.1 | hypothetical protein | - |
ECTO217_RS27270 | 76683..76841 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 76885..76916 | - | 32 | NuclAT_1 | - | Antitoxin |
- | 76885..76916 | - | 32 | NuclAT_1 | - | Antitoxin |
- | 76885..76916 | - | 32 | NuclAT_1 | - | Antitoxin |
- | 76885..76916 | - | 32 | NuclAT_1 | - | Antitoxin |
- | 78358..78555 | - | 198 | NuclAT_0 | - | - |
- | 78358..78555 | - | 198 | NuclAT_0 | - | - |
- | 78358..78555 | - | 198 | NuclAT_0 | - | - |
- | 78358..78555 | - | 198 | NuclAT_0 | - | - |
ECTO217_RS28415 | 78367..78555 | + | 189 | WP_001299721.1 | hypothetical protein | - |
ECTO217_RS27280 | 78567..79286 | - | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
ECTO217_RS27285 | 79283..79717 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
ECTO217_RS27290 | 79772..79969 | - | 198 | Protein_99 | hypothetical protein | - |
ECTO217_RS27295 | 79997..80230 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
ECTO217_RS27300 | 80298..80795 | - | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | iutA / iucD | 1..128948 | 128948 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T292965 WP_001312861.1 NZ_LS992193:c76841-76683 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 32 bp
>AT292965 NZ_LS992193:c76916-76885 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|