Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 85079..85343 | Replicon | plasmid 3 |
Accession | NZ_LS992187 | ||
Organism | Escherichia coli isolate Escherichia coli str. 3426 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | EC3426_RS25660 | Protein ID | WP_001331364.1 |
Coordinates | 85191..85343 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 85079..85141 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC3426_RS25645 | 80318..82609 | - | 2292 | WP_021520372.1 | hypothetical protein | - |
EC3426_RS25650 | 82602..83672 | - | 1071 | WP_001542508.1 | IncI1-type conjugal transfer protein TrbB | - |
EC3426_RS25655 | 83691..84899 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 85079..85141 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 85079..85141 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 85079..85141 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 85079..85141 | - | 63 | NuclAT_0 | - | Antitoxin |
EC3426_RS25660 | 85191..85343 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
EC3426_RS25665 | 85415..85666 | - | 252 | WP_001291964.1 | hypothetical protein | - |
EC3426_RS25670 | 85966..86262 | + | 297 | WP_001275298.1 | hypothetical protein | - |
EC3426_RS27040 | 86327..86503 | - | 177 | WP_001054897.1 | hypothetical protein | - |
EC3426_RS25675 | 86894..87103 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
EC3426_RS25680 | 87175..87837 | - | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
EC3426_RS25685 | 87908..90076 | - | 2169 | WP_000698354.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..99072 | 99072 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T292900 WP_001331364.1 NZ_LS992187:85191-85343 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT292900 NZ_LS992187:c85141-85079 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|