Detailed information of TA system TA292895

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 120928..121182
• Replicon: plasmid 2
• Accession: NZ_LS992186
• Organism: Escherichia coli isolate Escherichia coli str. 3426

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: EC3426_RS24800
• Protein ID: WP_032215358.1
• Coordinates: 120928..121134 (-)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	121121..121182 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
EC3426_RS24765	116440..117021	-	582	Protein_117	3'-5' exonuclease	-
EC3426_RS24770	117227..118237	+	1011	WP_089634347.1	IS110 family transposase	-
EC3426_RS24780	119227..120084	-	858	WP_029702152.1	incFII family plasmid replication initiator RepA	-
EC3426_RS24785	120077..120151	-	75	WP_001365705.1	RepA leader peptide Tap	-
EC3426_RS24795	120387..120644	-	258	WP_000083833.1	replication regulatory protein RepA	-
EC3426_RS24800	120928..121134	-	207	WP_032215358.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	121121..121182	+	62	NuclAT_1	-	Antitoxin
-	121121..121182	+	62	NuclAT_1	-	Antitoxin
-	121121..121182	+	62	NuclAT_1	-	Antitoxin
-	121121..121182	+	62	NuclAT_1	-	Antitoxin
EC3426_RS27150	121321..121587	-	267	WP_087757657.1	hypothetical protein	-
EC3426_RS24815	121962..122531	-	570	WP_029702150.1	DUF2726 domain-containing protein	-
EC3426_RS24820	122683..123309	-	627	WP_029702149.1	hypothetical protein	-
EC3426_RS24825	123721..123930	-	210	WP_039023209.1	hypothetical protein	-
EC3426_RS24830	124061..124621	-	561	WP_001567328.1	fertility inhibition protein FinO	-
EC3426_RS24835	124676..125422	-	747	WP_052273601.1	conjugal transfer pilus acetylase TraX	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	-	-	1..164477	164477

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7778.27 Da
• Isoelectric Point: 8.8807

>T292895 WP_032215358.1 NZ_LS992186:c121134-120928 [Escherichia coli]
MKYLNTTDCSLFLAERSKFMTKYALIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

Antitoxin

Nucleotide

• Length: 62 bp

>AT292895 NZ_LS992186:121121-121182 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin