Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 120928..121182 | Replicon | plasmid 2 |
| Accession | NZ_LS992186 | ||
| Organism | Escherichia coli isolate Escherichia coli str. 3426 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | - |
| Locus tag | EC3426_RS24800 | Protein ID | WP_032215358.1 |
| Coordinates | 120928..121134 (-) | Length | 69 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 121121..121182 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC3426_RS24765 | 116440..117021 | - | 582 | Protein_117 | 3'-5' exonuclease | - |
| EC3426_RS24770 | 117227..118237 | + | 1011 | WP_089634347.1 | IS110 family transposase | - |
| EC3426_RS24780 | 119227..120084 | - | 858 | WP_029702152.1 | incFII family plasmid replication initiator RepA | - |
| EC3426_RS24785 | 120077..120151 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| EC3426_RS24795 | 120387..120644 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| EC3426_RS24800 | 120928..121134 | - | 207 | WP_032215358.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 121121..121182 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 121121..121182 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 121121..121182 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 121121..121182 | + | 62 | NuclAT_1 | - | Antitoxin |
| EC3426_RS27150 | 121321..121587 | - | 267 | WP_087757657.1 | hypothetical protein | - |
| EC3426_RS24815 | 121962..122531 | - | 570 | WP_029702150.1 | DUF2726 domain-containing protein | - |
| EC3426_RS24820 | 122683..123309 | - | 627 | WP_029702149.1 | hypothetical protein | - |
| EC3426_RS24825 | 123721..123930 | - | 210 | WP_039023209.1 | hypothetical protein | - |
| EC3426_RS24830 | 124061..124621 | - | 561 | WP_001567328.1 | fertility inhibition protein FinO | - |
| EC3426_RS24835 | 124676..125422 | - | 747 | WP_052273601.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..164477 | 164477 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7778.27 Da Isoelectric Point: 8.8807
>T292895 WP_032215358.1 NZ_LS992186:c121134-120928 [Escherichia coli]
MKYLNTTDCSLFLAERSKFMTKYALIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFLAERSKFMTKYALIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
Antitoxin
Download Length: 62 bp
>AT292895 NZ_LS992186:121121-121182 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|