Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4321321..4322120 | Replicon | chromosome |
Accession | NZ_LS992185 | ||
Organism | Escherichia coli isolate Escherichia coli str. 3426 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | D3GWU5 |
Locus tag | EC3426_RS21175 | Protein ID | WP_000347272.1 |
Coordinates | 4321656..4322120 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | EC3426_RS21170 | Protein ID | WP_001307405.1 |
Coordinates | 4321321..4321656 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC3426_RS21155 | 4317106..4317876 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
EC3426_RS21160 | 4317892..4319226 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
EC3426_RS21165 | 4319601..4321172 | + | 1572 | WP_001273738.1 | galactarate dehydratase | - |
EC3426_RS21170 | 4321321..4321656 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
EC3426_RS21175 | 4321656..4322120 | + | 465 | WP_000347272.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
EC3426_RS21180 | 4322175..4322984 | - | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
EC3426_RS21185 | 4323233..4324513 | + | 1281 | WP_001521382.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
EC3426_RS21190 | 4324536..4325009 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
EC3426_RS21195 | 4325020..4325799 | + | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
EC3426_RS21200 | 4325789..4326667 | + | 879 | WP_001298314.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
EC3426_RS21205 | 4326685..4327119 | + | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4312396..4322120 | 9724 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17832.26 Da Isoelectric Point: 9.6924
>T292890 WP_000347272.1 NZ_LS992185:4321656-4322120 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829KUD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |