Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3877143..3877870 | Replicon | chromosome |
| Accession | NZ_LS992185 | ||
| Organism | Escherichia coli isolate Escherichia coli str. 3426 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A829L2T9 |
| Locus tag | EC3426_RS19025 | Protein ID | WP_001521139.1 |
| Coordinates | 3877559..3877870 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EC3426_RS19020 | Protein ID | WP_000126294.1 |
| Coordinates | 3877143..3877562 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC3426_RS19000 | 3872228..3872755 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
| EC3426_RS19005 | 3872904..3873914 | - | 1011 | WP_015912547.1 | DNA-binding transcriptional regulator AscG | - |
| EC3426_RS19010 | 3874174..3875631 | + | 1458 | WP_020234027.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| EC3426_RS19015 | 3875640..3877064 | + | 1425 | WP_020234028.1 | 6-phospho-beta-glucosidase AscB | - |
| EC3426_RS19020 | 3877143..3877562 | - | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EC3426_RS19025 | 3877559..3877870 | - | 312 | WP_001521139.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| EC3426_RS19030 | 3878037..3878507 | - | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| EC3426_RS19035 | 3878500..3878910 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| EC3426_RS19040 | 3878907..3879674 | - | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| EC3426_RS19045 | 3879674..3880216 | - | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| EC3426_RS19050 | 3880226..3881935 | - | 1710 | WP_001521140.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12493.23 Da Isoelectric Point: 9.4783
>T292886 WP_001521139.1 NZ_LS992185:c3877870-3877559 [Escherichia coli]
MHIISKAPFEECARKYPNDALALYSLYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALYSLYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT292886 WP_000126294.1 NZ_LS992185:c3877562-3877143 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|