Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2000257..2001052 | Replicon | chromosome |
| Accession | NZ_LS992185 | ||
| Organism | Escherichia coli isolate Escherichia coli str. 3426 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B7UP43 |
| Locus tag | EC3426_RS09680 | Protein ID | WP_000854914.1 |
| Coordinates | 2000678..2001052 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7UP42 |
| Locus tag | EC3426_RS09675 | Protein ID | WP_001280955.1 |
| Coordinates | 2000257..2000631 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC3426_RS09640 | 1995612..1996517 | + | 906 | WP_023149949.1 | hypothetical protein | - |
| EC3426_RS09645 | 1996514..1997584 | + | 1071 | WP_000102669.1 | patatin-like phospholipase family protein | - |
| EC3426_RS09655 | 1997924..1998742 | + | 819 | WP_001234682.1 | DUF945 domain-containing protein | - |
| EC3426_RS09660 | 1998833..1999318 | + | 486 | WP_000214398.1 | antirestriction protein | - |
| EC3426_RS09665 | 1999334..1999810 | + | 477 | WP_001186738.1 | RadC family protein | - |
| EC3426_RS09670 | 1999873..2000094 | + | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| EC3426_RS09675 | 2000257..2000631 | + | 375 | WP_001280955.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EC3426_RS09680 | 2000678..2001052 | + | 375 | WP_000854914.1 | TA system toxin CbtA family protein | Toxin |
| EC3426_RS09685 | 2001049..2001540 | + | 492 | WP_000976857.1 | hypothetical protein | - |
| EC3426_RS09690 | 2001552..2001749 | + | 198 | WP_000839282.1 | DUF957 domain-containing protein | - |
| EC3426_RS09695 | 2001834..2002676 | + | 843 | WP_001280481.1 | DUF4942 domain-containing protein | - |
| EC3426_RS09705 | 2003147..2004085 | + | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| EC3426_RS09710 | 2004140..2004877 | + | 738 | WP_000283667.1 | zinc-binding phosphatase | - |
| EC3426_RS09715 | 2004901..2005455 | + | 555 | WP_001001921.1 | molecular chaperone YcdY | - |
| EC3426_RS09720 | 2005557..2006048 | + | 492 | WP_001300785.1 | DUF1097 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | csgG / csgF / csgE / csgD / csgB / csgA / csgC | 1999334..2011614 | 12280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14117.17 Da Isoelectric Point: 7.7761
>T292877 WP_000854914.1 NZ_LS992185:2000678-2001052 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13767.59 Da Isoelectric Point: 6.6248
>AT292877 WP_001280955.1 NZ_LS992185:2000257-2000631 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LXR5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9P0D0 |