Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 20835..21492 Replicon plasmid 2
Accession NZ_LS992184
Organism Citrobacter freundii isolate Citrobacter freundii str. U2785

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag CFU2785_RS25115 Protein ID WP_000270043.1
Coordinates 20835..21185 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag CFU2785_RS25120 Protein ID WP_000124640.1
Coordinates 21190..21492 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CFU2785_RS25065 16390..17094 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
CFU2785_RS25075 17309..17806 - 498 WP_000062185.1 hypothetical protein -
CFU2785_RS25080 17809..18297 - 489 WP_001273096.1 DUF1643 domain-containing protein -
CFU2785_RS25085 18394..18729 + 336 WP_000683476.1 hypothetical protein -
CFU2785_RS25090 18744..19214 - 471 WP_001281821.1 hypothetical protein -
CFU2785_RS25095 19207..19578 - 372 WP_000516916.1 hypothetical protein -
CFU2785_RS25100 19589..19783 - 195 WP_000343597.1 hypothetical protein -
CFU2785_RS25110 20124..20672 - 549 WP_001061574.1 transcriptional regulator -
CFU2785_RS25115 20835..21185 + 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
CFU2785_RS25120 21190..21492 + 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
CFU2785_RS25125 21519..21812 - 294 WP_001239997.1 chromosome segregation protein ParM -
CFU2785_RS25130 21900..22172 - 273 WP_001043047.1 HU family DNA-binding protein -
CFU2785_RS25135 22230..22757 - 528 WP_001236377.1 thermonuclease family protein -
CFU2785_RS25140 22774..22962 - 189 WP_001270411.1 hypothetical protein -
CFU2785_RS25145 22988..23845 - 858 WP_001167032.1 hypothetical protein -
CFU2785_RS25150 23832..24062 - 231 WP_000972663.1 hypothetical protein -
CFU2785_RS25155 24062..24580 - 519 WP_000210756.1 nitrite reductase -
CFU2785_RS25160 24577..25023 - 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
CFU2785_RS25165 25023..25382 - 360 WP_000422768.1 hypothetical protein -
CFU2785_RS25170 25439..25867 - 429 WP_000591074.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid msr(E) / mph(E) / floR / tet(A) / blaCMY-2 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / ARR-3 / cmlA1 / blaOXA-10 / ant(3'')-Ia / qacE / sul1 / armA - 1..185156 185156


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T292865 WP_000270043.1 NZ_LS992184:20835-21185 [Citrobacter freundii]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT292865 WP_000124640.1 NZ_LS992184:21190-21492 [Citrobacter freundii]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References