Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4629068..4629738 | Replicon | chromosome |
Accession | NZ_LS992183 | ||
Organism | Citrobacter freundii isolate Citrobacter freundii str. U2785 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | CFU2785_RS23100 | Protein ID | WP_134216415.1 |
Coordinates | 4629068..4629370 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | CFU2785_RS23105 | Protein ID | WP_046671375.1 |
Coordinates | 4629397..4629738 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFU2785_RS23080 | 4624611..4626134 | - | 1524 | WP_003031804.1 | sugar ABC transporter ATP-binding protein | - |
CFU2785_RS23090 | 4626249..4628513 | + | 2265 | WP_134216414.1 | hybrid sensor histidine kinase/response regulator | - |
CFU2785_RS23095 | 4628583..4628912 | + | 330 | WP_003031807.1 | hypothetical protein | - |
CFU2785_RS23100 | 4629068..4629370 | + | 303 | WP_134216415.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFU2785_RS23105 | 4629397..4629738 | + | 342 | WP_046671375.1 | HigA family addiction module antidote protein | Antitoxin |
CFU2785_RS23110 | 4629791..4630549 | - | 759 | WP_134216416.1 | phosphonate metabolism protein PhnP | - |
CFU2785_RS23115 | 4630558..4630992 | - | 435 | WP_003031809.1 | aminoalkylphosphonate N-acetyltransferase | - |
CFU2785_RS23120 | 4630979..4631533 | - | 555 | WP_003844764.1 | ribose 1,5-bisphosphokinase | - |
CFU2785_RS23125 | 4631536..4632672 | - | 1137 | WP_003031811.1 | alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase | - |
CFU2785_RS23130 | 4632669..4633349 | - | 681 | WP_134216417.1 | phosphonate C-P lyase system protein PhnL | - |
CFU2785_RS23135 | 4633439..4634197 | - | 759 | WP_003844769.1 | phosphonate C-P lyase system protein PhnK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11835.48 Da Isoelectric Point: 9.9581
>T292862 WP_134216415.1 NZ_LS992183:4629068-4629370 [Citrobacter freundii]
MSKSLNIRSFRDTWLEDFFERATSHRKILADIHTALARKLDIINAAVSHRDLRSPPGNRYEELTGKLQEYSSIRVNKQYR
LIFKWVNGKAEDVYLDPHIY
MSKSLNIRSFRDTWLEDFFERATSHRKILADIHTALARKLDIINAAVSHRDLRSPPGNRYEELTGKLQEYSSIRVNKQYR
LIFKWVNGKAEDVYLDPHIY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|