Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 123998..124424 | Replicon | plasmid 2 |
Accession | NZ_LS992181 | ||
Organism | Escherichia coli isolate Escherichia coli str. TO124 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | ECTO124_RS26425 | Protein ID | WP_001312861.1 |
Coordinates | 123998..124156 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 124200..124424 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECTO124_RS26390 | 119395..120084 | - | 690 | WP_000283387.1 | conjugal transfer transcriptional regulator TraJ | - |
ECTO124_RS26395 | 120271..120654 | - | 384 | WP_001151538.1 | relaxosome protein TraM | - |
ECTO124_RS26400 | 120975..121577 | + | 603 | Protein_141 | transglycosylase SLT domain-containing protein | - |
ECTO124_RS26405 | 121874..122695 | - | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
ECTO124_RS26410 | 122805..123101 | - | 297 | WP_001545326.1 | hypothetical protein | - |
ECTO124_RS26420 | 123493..123697 | + | 205 | Protein_144 | pilus protein | - |
ECTO124_RS26425 | 123998..124156 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 124200..124424 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 124200..124424 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 124200..124424 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 124200..124424 | - | 225 | NuclAT_0 | - | Antitoxin |
ECTO124_RS27640 | 124236..124415 | + | 180 | WP_001309233.1 | hypothetical protein | - |
ECTO124_RS26430 | 124436..125155 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
ECTO124_RS26435 | 125152..125586 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
ECTO124_RS26440 | 125655..127619 | - | 1965 | WP_001537566.1 | ParB/RepB/Spo0J family partition protein | - |
ECTO124_RS26445 | 127680..127913 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
ECTO124_RS26450 | 127971..128498 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | senB | 1..149633 | 149633 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T292836 WP_001312861.1 NZ_LS992181:c124156-123998 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 225 bp
>AT292836 NZ_LS992181:c124424-124200 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|