Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 78976..79229 | Replicon | plasmid 2 |
| Accession | NZ_LS992181 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO124 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A148HBD8 |
| Locus tag | ECTO124_RS26140 | Protein ID | WP_001336447.1 |
| Coordinates | 78976..79125 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 79173..79229 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO124_RS26090 | 74451..75221 | + | 771 | WP_000712166.1 | molybdopterin-dependent oxidoreductase | - |
| ECTO124_RS26095 | 75251..75499 | + | 249 | WP_000738203.1 | hypothetical protein | - |
| ECTO124_RS27770 | 75649..75747 | - | 99 | WP_137491101.1 | transposase | - |
| ECTO124_RS26105 | 75940..76248 | + | 309 | Protein_87 | transposase | - |
| ECTO124_RS26110 | 76363..76575 | - | 213 | WP_001336932.1 | hypothetical protein | - |
| ECTO124_RS26120 | 77276..78133 | - | 858 | WP_001537577.1 | incFII family plasmid replication initiator RepA | - |
| ECTO124_RS26125 | 78126..78200 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| ECTO124_RS26135 | 78434..78691 | - | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
| ECTO124_RS26140 | 78976..79125 | - | 150 | WP_001336447.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 79173..79229 | + | 57 | NuclAT_1 | - | Antitoxin |
| - | 79173..79229 | + | 57 | NuclAT_1 | - | Antitoxin |
| - | 79173..79229 | + | 57 | NuclAT_1 | - | Antitoxin |
| - | 79173..79229 | + | 57 | NuclAT_1 | - | Antitoxin |
| ECTO124_RS26150 | 79324..79761 | - | 438 | WP_000872609.1 | hypothetical protein | - |
| ECTO124_RS26155 | 79914..80297 | - | 384 | WP_001109264.1 | hypothetical protein | - |
| ECTO124_RS26160 | 80400..80861 | - | 462 | WP_000760080.1 | thermonuclease family protein | - |
| ECTO124_RS26165 | 81614..81817 | - | 204 | WP_001336517.1 | hypothetical protein | - |
| ECTO124_RS26170 | 81969..82526 | - | 558 | WP_000139329.1 | fertility inhibition protein FinO | - |
| ECTO124_RS26175 | 82581..83327 | - | 747 | WP_000205709.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | senB | 1..149633 | 149633 | |
| - | flank | IS/Tn | - | - | 75982..76248 | 266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T292832 WP_001336447.1 NZ_LS992181:c79125-78976 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 57 bp
>AT292832 NZ_LS992181:79173-79229 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
