Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4927523..4928125 | Replicon | chromosome |
| Accession | NZ_LS992180 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO124 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | ECTO124_RS24600 | Protein ID | WP_000897302.1 |
| Coordinates | 4927814..4928125 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | ECTO124_RS24595 | Protein ID | WP_000356397.1 |
| Coordinates | 4927523..4927813 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO124_RS24555 | 4922830..4923759 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
| ECTO124_RS24560 | 4923941..4924183 | - | 243 | WP_001068514.1 | ribbon-helix-helix domain-containing protein | - |
| ECTO124_RS24565 | 4924473..4925321 | + | 849 | WP_001038650.1 | hypothetical protein | - |
| ECTO124_RS24570 | 4925637..4926086 | + | 450 | WP_032140890.1 | hypothetical protein | - |
| ECTO124_RS24575 | 4926271..4926489 | - | 219 | WP_001251293.1 | ribbon-helix-helix domain-containing protein | - |
| ECTO124_RS24585 | 4926886..4927164 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| ECTO124_RS24595 | 4927523..4927813 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
| ECTO124_RS24600 | 4927814..4928125 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| ECTO124_RS24605 | 4928354..4929262 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| ECTO124_RS24610 | 4929326..4930267 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| ECTO124_RS24615 | 4930312..4930749 | - | 438 | WP_000560981.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| ECTO124_RS24620 | 4930746..4931618 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| ECTO124_RS24625 | 4931612..4932211 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T292830 WP_000897302.1 NZ_LS992180:c4928125-4927814 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|