Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3735251..3735930 | Replicon | chromosome |
Accession | NZ_LS992180 | ||
Organism | Escherichia coli isolate Escherichia coli str. TO124 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | ECTO124_RS18855 | Protein ID | WP_000057523.1 |
Coordinates | 3735628..3735930 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | ECTO124_RS18850 | Protein ID | WP_000806442.1 |
Coordinates | 3735251..3735592 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECTO124_RS18840 | 3731495..3732427 | - | 933 | WP_000883041.1 | glutaminase A | - |
ECTO124_RS18845 | 3732689..3735193 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
ECTO124_RS18850 | 3735251..3735592 | - | 342 | WP_000806442.1 | HigA family addiction module antidote protein | Antitoxin |
ECTO124_RS18855 | 3735628..3735930 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ECTO124_RS18860 | 3736063..3736857 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
ECTO124_RS18865 | 3737061..3737540 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
ECTO124_RS18870 | 3737564..3738364 | + | 801 | WP_000439798.1 | hypothetical protein | - |
ECTO124_RS18875 | 3738361..3738864 | + | 504 | WP_000667000.1 | hypothetical protein | - |
ECTO124_RS18880 | 3738902..3740554 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T292821 WP_000057523.1 NZ_LS992180:c3735930-3735628 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|