Detailed information of TA system TA292788

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 71626..72052
• Replicon: plasmid 2
• Accession: NZ_LS992172
• Organism: Escherichia coli isolate Escherichia coli str. TO73

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: ECTO73_RS23705
• Protein ID: WP_001312861.1
• Coordinates: 71626..71784 (-)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	71828..72052 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ECTO73_RS23660	66817..67044	+	228	WP_000450520.1	toxin-antitoxin system antitoxin VapB	-
ECTO73_RS23665	67044..67442	+	399	WP_000911313.1	tRNA(fMet)-specific endonuclease VapC	-
ECTO73_RS23670	67451..68932	-	1482	Protein_71	type IV conjugative transfer system coupling protein TraD	-
ECTO73_RS23675	68986..69690	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
ECTO73_RS24220	69754..69993	-	240	Protein_73	IS6 family transposase	-
ECTO73_RS23685	70058..70300	-	243	Protein_74	DUF932 domain-containing protein	-
ECTO73_RS23690	70418..70705	-	288	WP_000107535.1	hypothetical protein	-
ECTO73_RS23705	71626..71784	-	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	71828..72052	-	225	NuclAT_0	-	Antitoxin
-	71828..72052	-	225	NuclAT_0	-	Antitoxin
-	71828..72052	-	225	NuclAT_0	-	Antitoxin
-	71828..72052	-	225	NuclAT_0	-	Antitoxin
ECTO73_RS24225	71864..72052	+	189	WP_001299721.1	hypothetical protein	-
ECTO73_RS23710	72064..72783	-	720	WP_001276238.1	plasmid SOS inhibition protein A	-
ECTO73_RS23715	72780..73214	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
ECTO73_RS23720	73269..73466	-	198	Protein_80	hypothetical protein	-
ECTO73_RS23725	73494..73727	-	234	WP_000005987.1	DUF905 family protein	-
ECTO73_RS23730	73795..74334	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
ECTO73_RS24320	74360..74566	-	207	WP_000275856.1	hypothetical protein	-
ECTO73_RS23755	75705..76676	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	sul2 / aph(3'')-Ib / aph(6)-Id / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..117801	117801

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T292788 WP_001312861.1 NZ_LS992172:c71784-71626 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT292788 NZ_LS992172:c72052-71828 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin