Detailed information of TA system TA292783

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 57939..58193
• Replicon: plasmid 2
• Accession: NZ_LS992172
• Organism: Escherichia coli isolate Escherichia coli str. TO73

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: ECTO73_RS23625
• Protein ID: WP_001351576.1
• Coordinates: 57939..58145 (-)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	58132..58193 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ECTO73_RS23580	53491..53892	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
ECTO73_RS23585	53825..54082	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
ECTO73_RS23590	54175..54828	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
ECTO73_RS23600	55767..56624	-	858	WP_000774297.1	incFII family plasmid replication initiator RepA	-
ECTO73_RS23605	56617..57099	-	483	WP_001273588.1	hypothetical protein	-
ECTO73_RS23610	57092..57166	-	75	WP_001442103.1	RepA leader peptide Tap	-
ECTO73_RS23620	57398..57655	-	258	WP_000083845.1	replication regulatory protein RepA	-
ECTO73_RS23625	57939..58145	-	207	WP_001351576.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	58132..58193	+	62	NuclAT_1	-	Antitoxin
-	58132..58193	+	62	NuclAT_1	-	Antitoxin
-	58132..58193	+	62	NuclAT_1	-	Antitoxin
-	58132..58193	+	62	NuclAT_1	-	Antitoxin
ECTO73_RS24315	58449..58523	-	75	Protein_63	endonuclease	-
ECTO73_RS23635	58769..58981	-	213	WP_001299730.1	ANR family transcriptional regulator	-
ECTO73_RS23640	59117..59677	-	561	WP_000139315.1	fertility inhibition protein FinO	-
ECTO73_RS23645	59780..60640	-	861	WP_025693494.1	alpha/beta hydrolase	-
ECTO73_RS23650	60699..61445	-	747	WP_000205749.1	conjugal transfer pilus acetylase TraX	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	sul2 / aph(3'')-Ib / aph(6)-Id / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..117801	117801

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7826.31 Da
• Isoelectric Point: 8.8807

>T292783 WP_001351576.1 NZ_LS992172:c58145-57939 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

Antitoxin

Nucleotide

• Length: 62 bp

>AT292783 NZ_LS992172:58132-58193 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin