Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3685107..3685801 | Replicon | chromosome |
| Accession | NZ_LS992171 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO73 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | ECTO73_RS18110 | Protein ID | WP_001263489.1 |
| Coordinates | 3685107..3685505 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | ECTO73_RS18115 | Protein ID | WP_000554758.1 |
| Coordinates | 3685508..3685801 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - | 3680695..3680775 | - | 81 | NuclAT_13 | - | - |
| - | 3680695..3680775 | - | 81 | NuclAT_13 | - | - |
| - | 3680695..3680775 | - | 81 | NuclAT_13 | - | - |
| - | 3680695..3680775 | - | 81 | NuclAT_13 | - | - |
| ECTO73_RS18085 | 3681371..3681829 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| ECTO73_RS18090 | 3682090..3683547 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| ECTO73_RS18095 | 3683604..3684125 | - | 522 | Protein_3511 | peptide chain release factor H | - |
| ECTO73_RS18100 | 3684121..3684327 | - | 207 | Protein_3512 | RtcB family protein | - |
| ECTO73_RS18105 | 3684645..3685097 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| ECTO73_RS18110 | 3685107..3685505 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| ECTO73_RS18115 | 3685508..3685801 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| ECTO73_RS18120 | 3685853..3686908 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| ECTO73_RS18125 | 3686979..3687764 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| ECTO73_RS18130 | 3687736..3689448 | + | 1713 | Protein_3518 | flagellar biosynthesis protein FlhA | - |
| ECTO73_RS18135 | 3689672..3690169 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | gmhA/lpcA / rhs/PAAR / vgrG/tssI | 3659293..3706814 | 47521 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T292776 WP_001263489.1 NZ_LS992171:c3685505-3685107 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |