Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 83922..84161 Replicon plasmid 2
Accession NZ_LS992169
Organism Escherichia coli isolate Escherichia coli str. TO60

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag ECTO60_RS25550 Protein ID WP_023144756.1
Coordinates 84027..84161 (+) Length 45 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 83922..83982 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO60_RS25515 79713..80273 + 561 WP_000139341.1 fertility inhibition protein FinO -
ECTO60_RS25520 80404..80616 + 213 WP_013023861.1 hypothetical protein -
ECTO60_RS25530 81175..81600 + 426 WP_000422741.1 IS66 family insertion sequence hypothetical protein -
ECTO60_RS25535 81597..81947 + 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
ECTO60_RS25540 81978..83591 + 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
ECTO60_RS26640 83669..83955 + 287 Protein_94 DUF2726 domain-containing protein -
- 83922..83982 - 61 NuclAT_2 - Antitoxin
- 83922..83982 - 61 NuclAT_2 - Antitoxin
- 83922..83982 - 61 NuclAT_2 - Antitoxin
- 83922..83982 - 61 NuclAT_2 - Antitoxin
ECTO60_RS25550 84027..84161 + 135 WP_023144756.1 type I toxin-antitoxin system Hok family toxin Toxin
ECTO60_RS25555 84458..84712 + 255 WP_000083850.1 replication regulatory protein RepA -
ECTO60_RS26775 84818..84952 + 135 Protein_97 protein CopA/IncA -
ECTO60_RS25560 84949..85023 + 75 WP_031943482.1 RepA leader peptide Tap -
ECTO60_RS25565 85016..85873 + 858 WP_001617855.1 incFII family plasmid replication initiator RepA -
ECTO60_RS25575 86813..87466 + 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
ECTO60_RS25580 87559..87816 + 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
ECTO60_RS25585 87749..88150 + 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aac(3)-IId / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 senB / senB 1..172923 172923


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T292754 WP_023144756.1 NZ_LS992169:84027-84161 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT292754 NZ_LS992169:c83982-83922 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References