Detailed information of TA system TA292750

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 42082..42324
• Replicon: plasmid 2
• Accession: NZ_LS992169
• Organism: Escherichia coli isolate Escherichia coli str. TO60

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: ECTO60_RS25300
• Protein ID: WP_001312861.1
• Coordinates: 42166..42324 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	42082..42122 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ECTO60_RS25280	37277..39235	+	1959	WP_000117179.1	ParB/RepB/Spo0J family partition protein	-
ECTO60_RS25285	39290..39724	+	435	WP_000845940.1	conjugation system SOS inhibitor PsiB	-
ECTO60_RS25290	39721..40440	+	720	WP_001276232.1	plasmid SOS inhibition protein A	-
-	40452..40638	+	187	NuclAT_0	-	-
-	40452..40638	+	187	NuclAT_0	-	-
-	40452..40638	+	187	NuclAT_0	-	-
-	40452..40638	+	187	NuclAT_0	-	-
ECTO60_RS25295	40686..42055	+	1370	WP_085947770.1	IS3-like element IS150 family transposase	-
-	42082..42122	+	41	NuclAT_1	-	Antitoxin
-	42082..42122	+	41	NuclAT_1	-	Antitoxin
-	42082..42122	+	41	NuclAT_1	-	Antitoxin
-	42082..42122	+	41	NuclAT_1	-	Antitoxin
ECTO60_RS25300	42166..42324	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
ECTO60_RS26765	42767..43102	+	336	WP_197731391.1	hypothetical protein	-
ECTO60_RS26770	43015..43221	+	207	WP_000275859.1	hypothetical protein	-
ECTO60_RS25320	43246..43533	+	288	WP_000107535.1	hypothetical protein	-
ECTO60_RS25325	43652..44473	+	822	WP_001234469.1	DUF945 domain-containing protein	-
ECTO60_RS25330	44770..45372	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
ECTO60_RS25335	45703..46086	+	384	WP_001151566.1	relaxosome protein TraM	-
ECTO60_RS25340	46220..46897	+	678	WP_001348626.1	PAS domain-containing protein	-
ECTO60_RS25345	46985..47212	+	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / aac(3)-IId / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17	senB / senB	1..172923	172923

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T292750 WP_001312861.1 NZ_LS992169:42166-42324 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

Antitoxin

Nucleotide

• Length: 41 bp

>AT292750 NZ_LS992169:42082-42122 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin