Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 42082..42324 | Replicon | plasmid 2 |
| Accession | NZ_LS992169 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO60 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | ECTO60_RS25300 | Protein ID | WP_001312861.1 |
| Coordinates | 42166..42324 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 42082..42122 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO60_RS25280 | 37277..39235 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
| ECTO60_RS25285 | 39290..39724 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| ECTO60_RS25290 | 39721..40440 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| - | 40452..40638 | + | 187 | NuclAT_0 | - | - |
| - | 40452..40638 | + | 187 | NuclAT_0 | - | - |
| - | 40452..40638 | + | 187 | NuclAT_0 | - | - |
| - | 40452..40638 | + | 187 | NuclAT_0 | - | - |
| ECTO60_RS25295 | 40686..42055 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - | 42082..42122 | + | 41 | NuclAT_1 | - | Antitoxin |
| - | 42082..42122 | + | 41 | NuclAT_1 | - | Antitoxin |
| - | 42082..42122 | + | 41 | NuclAT_1 | - | Antitoxin |
| - | 42082..42122 | + | 41 | NuclAT_1 | - | Antitoxin |
| ECTO60_RS25300 | 42166..42324 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| ECTO60_RS26765 | 42767..43102 | + | 336 | WP_197731391.1 | hypothetical protein | - |
| ECTO60_RS26770 | 43015..43221 | + | 207 | WP_000275859.1 | hypothetical protein | - |
| ECTO60_RS25320 | 43246..43533 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| ECTO60_RS25325 | 43652..44473 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| ECTO60_RS25330 | 44770..45372 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| ECTO60_RS25335 | 45703..46086 | + | 384 | WP_001151566.1 | relaxosome protein TraM | - |
| ECTO60_RS25340 | 46220..46897 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| ECTO60_RS25345 | 46985..47212 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB / senB | 1..172923 | 172923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T292750 WP_001312861.1 NZ_LS992169:42166-42324 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 41 bp
>AT292750 NZ_LS992169:42082-42122 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|