Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3828210..3828904 | Replicon | chromosome |
Accession | NZ_LS992166 | ||
Organism | Escherichia coli isolate Escherichia coli str. TO6 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | ECTO6_RS18885 | Protein ID | WP_001263489.1 |
Coordinates | 3828210..3828608 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | ECTO6_RS18890 | Protein ID | WP_000554758.1 |
Coordinates | 3828611..3828904 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- | 3823798..3823878 | - | 81 | NuclAT_11 | - | - |
- | 3823798..3823878 | - | 81 | NuclAT_11 | - | - |
- | 3823798..3823878 | - | 81 | NuclAT_11 | - | - |
- | 3823798..3823878 | - | 81 | NuclAT_11 | - | - |
ECTO6_RS18860 | 3824474..3824932 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
ECTO6_RS18865 | 3825193..3826650 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
ECTO6_RS18870 | 3826707..3827228 | - | 522 | Protein_3667 | peptide chain release factor H | - |
ECTO6_RS18875 | 3827224..3827430 | - | 207 | Protein_3668 | RtcB family protein | - |
ECTO6_RS18880 | 3827748..3828200 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
ECTO6_RS18885 | 3828210..3828608 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
ECTO6_RS18890 | 3828611..3828904 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
ECTO6_RS18895 | 3828956..3830011 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
ECTO6_RS18900 | 3830082..3830867 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
ECTO6_RS18905 | 3830839..3832551 | + | 1713 | Protein_3674 | flagellar biosynthesis protein FlhA | - |
ECTO6_RS18910 | 3832775..3833272 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T292717 WP_001263489.1 NZ_LS992166:c3828608-3828210 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |