Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2546801..2547439 | Replicon | chromosome |
| Accession | NZ_LS992166 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO6 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | ECTO6_RS12575 | Protein ID | WP_000813794.1 |
| Coordinates | 2547263..2547439 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | ECTO6_RS12570 | Protein ID | WP_001270286.1 |
| Coordinates | 2546801..2547217 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO6_RS12550 | 2541953..2542894 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
| ECTO6_RS12555 | 2542895..2543908 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| ECTO6_RS12560 | 2543926..2545071 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| ECTO6_RS12565 | 2545316..2546722 | - | 1407 | WP_134091812.1 | PLP-dependent aminotransferase family protein | - |
| ECTO6_RS12570 | 2546801..2547217 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| ECTO6_RS12575 | 2547263..2547439 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| ECTO6_RS12580 | 2547661..2547891 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| ECTO6_RS12585 | 2547983..2549944 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| ECTO6_RS12590 | 2550017..2550553 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| ECTO6_RS12595 | 2550606..2551820 | + | 1215 | WP_071607158.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 2551860..2553008 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T292715 WP_000813794.1 NZ_LS992166:c2547439-2547263 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT292715 WP_001270286.1 NZ_LS992166:c2547217-2546801 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|