Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1291986..1292625 | Replicon | chromosome |
| Accession | NZ_LS483486 | ||
| Organism | Haemophilus influenzae strain NCTC12194 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q4QJX7 |
| Locus tag | DQL18_RS06555 | Protein ID | WP_005650215.1 |
| Coordinates | 1291986..1292291 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | DQL18_RS06560 | Protein ID | WP_005650217.1 |
| Coordinates | 1292302..1292625 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL18_RS06535 | 1287416..1289455 | - | 2040 | WP_038441065.1 | excinuclease ABC subunit B | - |
| DQL18_RS06545 | 1290070..1291038 | - | 969 | WP_042593950.1 | zinc transporter permease subunit ZevB | - |
| DQL18_RS06550 | 1291041..1291661 | - | 621 | WP_005694310.1 | zinc transporter binding subunit ZevA | - |
| DQL18_RS06555 | 1291986..1292291 | + | 306 | WP_005650215.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQL18_RS06560 | 1292302..1292625 | + | 324 | WP_005650217.1 | HigA family addiction module antidote protein | Antitoxin |
| DQL18_RS06565 | 1292788..1294458 | + | 1671 | WP_005650218.1 | energy-dependent translational throttle protein EttA | - |
| DQL18_RS06570 | 1294520..1294861 | + | 342 | WP_005652996.1 | SirB2 family protein | - |
| DQL18_RS06575 | 1294866..1296836 | + | 1971 | WP_105905558.1 | tRNA(Met) cytidine acetyltransferase TmcA | - |
| DQL18_RS09810 | 1296833..1297006 | + | 174 | WP_011272700.1 | DUF5363 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12301.93 Da Isoelectric Point: 9.0853
>T292650 WP_005650215.1 NZ_LS483486:1291986-1292291 [Haemophilus influenzae]
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|