Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA-HipA |
Location | 376214..377562 | Replicon | chromosome |
Accession | NZ_LS483486 | ||
Organism | Haemophilus influenzae strain NCTC12194 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | - |
Locus tag | DQL18_RS01885 | Protein ID | WP_105905586.1 |
Coordinates | 376531..377562 (+) | Length | 344 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | A0A2S9R6P7 |
Locus tag | DQL18_RS01880 | Protein ID | WP_005650823.1 |
Coordinates | 376214..376534 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL18_RS01840 | 371640..371918 | + | 279 | WP_005661211.1 | cell division protein FtsB | - |
DQL18_RS01845 | 371918..372595 | + | 678 | WP_005655267.1 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | - |
DQL18_RS01850 | 372592..373068 | + | 477 | WP_005687916.1 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | - |
DQL18_RS01855 | 373373..373807 | - | 435 | WP_013526377.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
DQL18_RS01860 | 373804..374244 | - | 441 | WP_005694621.1 | FMN-binding protein MioC | - |
DQL18_RS01865 | 374341..374560 | - | 220 | Protein_348 | cell division protein ZapB | - |
DQL18_RS01870 | 374722..375723 | + | 1002 | WP_005690169.1 | class II fructose-bisphosphatase | - |
DQL18_RS01875 | 375918..376226 | + | 309 | WP_005661200.1 | helix-turn-helix domain-containing protein | - |
DQL18_RS01880 | 376214..376534 | + | 321 | WP_005650823.1 | type II toxin-antitoxin system HipA family toxin | Antitoxin |
DQL18_RS01885 | 376531..377562 | + | 1032 | WP_105905586.1 | type II toxin-antitoxin system HipA family toxin | Toxin |
DQL18_RS01890 | 377646..379304 | - | 1659 | WP_105905587.1 | thiol reductant ABC exporter subunit CydC | - |
DQL18_RS01895 | 379297..381042 | - | 1746 | WP_105905588.1 | ABC transporter ATP-binding protein/permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 344 a.a. Molecular weight: 39821.33 Da Isoelectric Point: 6.4338
>T292644 WP_105905586.1 NZ_LS483486:376531-377562 [Haemophilus influenzae]
MNFCRILLKPLKKNEVHSGYSTKGLHYLTGNKNFNPELPFSRQEFITVKPQKQQGMSISGFQPKLQLIIKDEHFDSVNQQ
GNYILKPSPEEYPFLAENEHATMRIMKELGFDVPENGLVSFAGEQNHKEFAFVIKRFDRDEQQTEIHQEQLDGAMNIRDK
YGKIGADNEQYVSYEQIAKFILQHTENHLAQQREIFRRIIYAYLLGNNDLHLRNFSFIYPKNSHPKLAPIYDFVSVSPYP
EIFNSTLLALPLLAREEGNATLAKGFNTQYGEYIGDDFVEFGENIGLNKNVIIQKLIPEITQEKEKVEQIYSQSFMPQPH
IDCVLKTYRKRLALLNVLNEPEL
MNFCRILLKPLKKNEVHSGYSTKGLHYLTGNKNFNPELPFSRQEFITVKPQKQQGMSISGFQPKLQLIIKDEHFDSVNQQ
GNYILKPSPEEYPFLAENEHATMRIMKELGFDVPENGLVSFAGEQNHKEFAFVIKRFDRDEQQTEIHQEQLDGAMNIRDK
YGKIGADNEQYVSYEQIAKFILQHTENHLAQQREIFRRIIYAYLLGNNDLHLRNFSFIYPKNSHPKLAPIYDFVSVSPYP
EIFNSTLLALPLLAREEGNATLAKGFNTQYGEYIGDDFVEFGENIGLNKNVIIQKLIPEITQEKEKVEQIYSQSFMPQPH
IDCVLKTYRKRLALLNVLNEPEL
Download Length: 1032 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|