Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-MqsA
Location 559450..560093 Replicon chromosome
Accession NZ_LS483485
Organism Aggregatibacter aphrophilus strain NCTC11096

Toxin (Protein)


Gene name higB Uniprot ID A0A336N815
Locus tag DQL22_RS02930 Protein ID WP_032995054.1
Coordinates 559450..559788 (+) Length 113 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag DQL22_RS02935 Protein ID WP_005640244.1
Coordinates 559785..560093 (+) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL22_RS02880 554557..555009 + 453 WP_111711196.1 hypothetical protein -
DQL22_RS02885 555034..555345 + 312 WP_111711197.1 hypothetical protein -
DQL22_RS02890 555430..555813 + 384 WP_005594660.1 hypothetical protein -
DQL22_RS02895 555835..556110 + 276 WP_111711198.1 hypothetical protein -
DQL22_RS02900 556107..556871 + 765 WP_111711199.1 antA/AntB antirepressor family protein -
DQL22_RS02905 556941..557369 + 429 WP_111711200.1 winged helix-turn-helix domain-containing protein -
DQL22_RS02910 557672..558199 + 528 WP_111711305.1 host cell division inhibitor Icd-like protein -
DQL22_RS02915 558192..558521 + 330 WP_005703564.1 hypothetical protein -
DQL22_RS02920 558521..558721 + 201 WP_005703563.1 hypothetical protein -
DQL22_RS02925 558708..559283 + 576 WP_111301179.1 hypothetical protein -
DQL22_RS02930 559450..559788 + 339 WP_032995054.1 toxin Toxin
DQL22_RS02935 559785..560093 + 309 WP_005640244.1 helix-turn-helix domain-containing protein Antitoxin
DQL22_RS02940 560818..561333 - 516 WP_005702040.1 Hcp family type VI secretion system effector -
DQL22_RS02945 562199..562609 + 411 WP_005702041.1 preprotein translocase subunit SecE -
DQL22_RS02950 562611..563162 + 552 WP_005702043.1 transcription termination/antitermination protein NusG -
DQL22_RS02955 563332..563760 + 429 WP_005630840.1 50S ribosomal protein L11 -
DQL22_RS02960 563765..564454 + 690 WP_005702044.1 50S ribosomal protein L1 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(35-110)

Antitoxin

Cro/C1-type helix-turn-helix domain

(40-80)


Sequences

Toxin        


Download         Length: 113 a.a.        Molecular weight: 13218.17 Da        Isoelectric Point: 9.4904

>T292640 WP_032995054.1 NZ_LS483485:559450-559788 [Aggregatibacter aphrophilus]
VKLSFIELPPFERYRKAYLSDDEYRAFQNELLENPEKGDVIQNTGGLRKIRIADSERNKGKRGGARVIYYYLIRKSRILL
VTAYSKNRCEDLTTEQYKILAKLVKEIEELEQ

Download         Length: 339 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11551.29 Da        Isoelectric Point: 8.5280

>AT292640 WP_005640244.1 NZ_LS483485:559785-560093 [Aggregatibacter aphrophilus]
MSELFDELIEGLNAYKDFTQGKITLRVETRERIEPASITAEEVKAIREKLNLSQAVFAQKLRTSVRTYQGWEQGKTKPSA
HASLLLRMVDKAPQTFELIAGI

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A336N815

Antitoxin

Source ID Structure

References