Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2152891..2153314 Replicon chromosome
Accession NZ_LS483484
Organism Staphylococcus aureus strain NCTC13277

Toxin (Protein)


Gene name higB Uniprot ID A0A7U7EW16
Locus tag DQL77_RS11030 Protein ID WP_001065092.1
Coordinates 2153063..2153314 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A0E0VQM8
Locus tag DQL77_RS11025 Protein ID WP_000028422.1
Coordinates 2152891..2153073 (-) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL77_RS10980 2148277..2149938 - 1662 WP_000625088.1 terminase large subunit -
DQL77_RS10985 2149935..2150279 - 345 WP_000402904.1 hypothetical protein -
DQL77_RS10990 2150409..2150708 - 300 WP_000988336.1 HNH endonuclease -
DQL77_RS10995 2150940..2151356 - 417 WP_000590122.1 hypothetical protein -
DQL77_RS11000 2151384..2151584 - 201 WP_000265043.1 DUF1514 family protein -
DQL77_RS11005 2151584..2151733 - 150 WP_000595265.1 transcriptional activator RinB -
DQL77_RS11010 2151730..2152116 - 387 WP_000592207.1 hypothetical protein -
DQL77_RS11015 2152113..2152319 - 207 WP_000195803.1 DUF1381 domain-containing protein -
DQL77_RS11020 2152356..2152898 - 543 WP_000185659.1 dUTP pyrophosphatase -
DQL77_RS11025 2152891..2153073 - 183 WP_000028422.1 hypothetical protein Antitoxin
DQL77_RS11030 2153063..2153314 - 252 WP_001065092.1 DUF1024 family protein Toxin
DQL77_RS15065 2153307..2153474 - 168 WP_001624242.1 hypothetical protein -
DQL77_RS11035 2153486..2153728 - 243 WP_000131366.1 hypothetical protein -
DQL77_RS11040 2153732..2154100 - 369 WP_000101274.1 hypothetical protein -
DQL77_RS11045 2154113..2154422 - 310 Protein_2056 RusA family crossover junction endodeoxyribonuclease -
DQL77_RS11050 2154431..2154649 - 219 WP_000338531.1 hypothetical protein -
DQL77_RS11055 2154656..2155529 - 874 Protein_2058 DnaD domain protein -
DQL77_RS11060 2155559..2156029 - 471 WP_000934764.1 single-stranded DNA-binding protein -
DQL77_RS11065 2156030..2156647 - 618 WP_071621397.1 MBL fold metallo-hydrolase -
DQL77_RS11070 2156728..2157648 - 921 WP_000138472.1 recombinase RecT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - map / hlb / scn / chp / sak / sea / hlb / groEL 2119449..2178441 58992
- inside Prophage - map / hlb / scn / chp / sak / sea / hlb / groEL 2102244..2178441 76197


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9375.25 Da        Isoelectric Point: 3.8567

>T292633 WP_001065092.1 NZ_LS483484:c2153314-2153063 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQYSVKEGVELDEAVGIMAGQVVYKYEEEQE
NEH

Download         Length: 252 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6741.63 Da        Isoelectric Point: 4.2658

>AT292633 WP_000028422.1 NZ_LS483484:c2153073-2152891 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEEQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U7EW16

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VQM8

References