Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2129581..2129880 | Replicon | chromosome |
Accession | NZ_LS483484 | ||
Organism | Staphylococcus aureus strain NCTC13277 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DQL77_RS10880 | Protein ID | WP_011447039.1 |
Coordinates | 2129704..2129880 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2129581..2129636 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL77_RS10835 | 2124910..2125170 | + | 261 | WP_001791826.1 | hypothetical protein | - |
DQL77_RS10840 | 2125223..2125573 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
DQL77_RS10845 | 2126259..2126708 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
DQL77_RS10850 | 2126803..2127138 | - | 336 | Protein_2017 | SH3 domain-containing protein | - |
DQL77_RS10860 | 2127788..2128279 | - | 492 | WP_000919350.1 | staphylokinase | - |
DQL77_RS10865 | 2128471..2129226 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DQL77_RS10870 | 2129238..2129492 | - | 255 | WP_000611512.1 | phage holin | - |
DQL77_RS10875 | 2129544..2129651 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2129573..2129712 | + | 140 | NuclAT_0 | - | - |
- | 2129573..2129712 | + | 140 | NuclAT_0 | - | - |
- | 2129573..2129712 | + | 140 | NuclAT_0 | - | - |
- | 2129573..2129712 | + | 140 | NuclAT_0 | - | - |
- | 2129581..2129636 | + | 56 | - | - | Antitoxin |
DQL77_RS10880 | 2129704..2129880 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
DQL77_RS10885 | 2129989..2130762 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
DQL77_RS10895 | 2131183..2131557 | - | 375 | WP_000340977.1 | hypothetical protein | - |
DQL77_RS10900 | 2131613..2131900 | - | 288 | WP_001040259.1 | hypothetical protein | - |
DQL77_RS10905 | 2131947..2132099 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | map / hlb / scn / chp / sak / sea / hlb / groEL | 2119449..2178441 | 58992 | |
- | inside | Prophage | - | map / hlb / scn / chp / sak / sea / hlb / groEL | 2102244..2178441 | 76197 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T292631 WP_011447039.1 NZ_LS483484:c2129880-2129704 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT292631 NZ_LS483484:2129581-2129636 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|