Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) txpA-SprF3/-
Location 2129581..2129880 Replicon chromosome
Accession NZ_LS483484
Organism Staphylococcus aureus strain NCTC13277

Toxin (Protein)


Gene name txpA Uniprot ID Q2FWU9
Locus tag DQL77_RS10880 Protein ID WP_011447039.1
Coordinates 2129704..2129880 (-) Length 59 a.a.

Antitoxin (RNA)


Gene name SprF3
Locus tag -
Coordinates 2129581..2129636 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL77_RS10835 2124910..2125170 + 261 WP_001791826.1 hypothetical protein -
DQL77_RS10840 2125223..2125573 - 351 WP_000702263.1 complement inhibitor SCIN-A -
DQL77_RS10845 2126259..2126708 + 450 WP_000727649.1 chemotaxis-inhibiting protein CHIPS -
DQL77_RS10850 2126803..2127138 - 336 Protein_2017 SH3 domain-containing protein -
DQL77_RS10860 2127788..2128279 - 492 WP_000919350.1 staphylokinase -
DQL77_RS10865 2128471..2129226 - 756 WP_000861038.1 CHAP domain-containing protein -
DQL77_RS10870 2129238..2129492 - 255 WP_000611512.1 phage holin -
DQL77_RS10875 2129544..2129651 + 108 WP_001791821.1 hypothetical protein -
- 2129573..2129712 + 140 NuclAT_0 - -
- 2129573..2129712 + 140 NuclAT_0 - -
- 2129573..2129712 + 140 NuclAT_0 - -
- 2129573..2129712 + 140 NuclAT_0 - -
- 2129581..2129636 + 56 - - Antitoxin
DQL77_RS10880 2129704..2129880 - 177 WP_011447039.1 putative holin-like toxin Toxin
DQL77_RS10885 2129989..2130762 - 774 WP_000750406.1 staphylococcal enterotoxin type A -
DQL77_RS10895 2131183..2131557 - 375 WP_000340977.1 hypothetical protein -
DQL77_RS10900 2131613..2131900 - 288 WP_001040259.1 hypothetical protein -
DQL77_RS10905 2131947..2132099 - 153 WP_001153681.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - map / hlb / scn / chp / sak / sea / hlb / groEL 2119449..2178441 58992
- inside Prophage - map / hlb / scn / chp / sak / sea / hlb / groEL 2102244..2178441 76197


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Small toxic protein BsrE-like

(30-58)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6849.45 Da        Isoelectric Point: 10.6777

>T292631 WP_011447039.1 NZ_LS483484:c2129880-2129704 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK

Download         Length: 177 bp

Antitoxin


Download         Length: 56 bp

>AT292631 NZ_LS483484:2129581-2129636 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
PDB 7NS1

Antitoxin

Download structure file

References