Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1613711..1614350 | Replicon | chromosome |
| Accession | NZ_LS483480 | ||
| Organism | Haemophilus influenzae strain NCTC13377 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q4QJX7 |
| Locus tag | DQL19_RS08290 | Protein ID | WP_005650215.1 |
| Coordinates | 1614045..1614350 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | DQL19_RS08285 | Protein ID | WP_005650217.1 |
| Coordinates | 1613711..1614034 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL19_RS09630 | 1609456..1609629 | - | 174 | WP_005652999.1 | DUF5363 domain-containing protein | - |
| DQL19_RS08270 | 1609626..1611470 | - | 1845 | WP_015702146.1 | tRNA(Met) cytidine acetyltransferase TmcA | - |
| DQL19_RS08275 | 1611475..1611816 | - | 342 | WP_005666735.1 | SirB2 family protein | - |
| DQL19_RS08280 | 1611878..1613548 | - | 1671 | WP_015702145.1 | energy-dependent translational throttle protein EttA | - |
| DQL19_RS08285 | 1613711..1614034 | - | 324 | WP_005650217.1 | HigA family addiction module antidote protein | Antitoxin |
| DQL19_RS08290 | 1614045..1614350 | - | 306 | WP_005650215.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQL19_RS08295 | 1614675..1615295 | + | 621 | WP_005650213.1 | zinc transporter binding subunit ZevA | - |
| DQL19_RS08300 | 1615298..1616266 | + | 969 | WP_015702144.1 | zinc transporter permease subunit ZevB | - |
| DQL19_RS08310 | 1616881..1618920 | + | 2040 | WP_005646675.1 | excinuclease ABC subunit B | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12301.93 Da Isoelectric Point: 9.0853
>T292620 WP_005650215.1 NZ_LS483480:c1614350-1614045 [Haemophilus influenzae]
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|