Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 1692111..1692700 | Replicon | chromosome |
Accession | NZ_LS483460 | ||
Organism | Corynebacterium minutissimum strain NCTC10288 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | DQN65_RS07725 | Protein ID | WP_082013920.1 |
Coordinates | 1692419..1692700 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | DQN65_RS07720 | Protein ID | WP_039674786.1 |
Coordinates | 1692111..1692410 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN65_RS07690 | 1687630..1688352 | + | 723 | WP_039674796.1 | hypothetical protein | - |
DQN65_RS07695 | 1688352..1688888 | + | 537 | WP_039674795.1 | DUF402 domain-containing protein | - |
DQN65_RS07700 | 1688933..1689853 | + | 921 | WP_039674794.1 | DUF808 domain-containing protein | - |
DQN65_RS07705 | 1689857..1690654 | - | 798 | WP_039674792.1 | zinc transporter ZupT | - |
DQN65_RS07710 | 1690780..1691598 | + | 819 | WP_039674788.1 | hypothetical protein | - |
DQN65_RS07715 | 1691847..1692101 | + | 255 | WP_039674787.1 | hypothetical protein | - |
DQN65_RS07720 | 1692111..1692410 | - | 300 | WP_039674786.1 | HigA family addiction module antidote protein | Antitoxin |
DQN65_RS07725 | 1692419..1692700 | - | 282 | WP_082013920.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQN65_RS07730 | 1693001..1694767 | - | 1767 | WP_039674782.1 | selenocysteine-specific translation elongation factor | - |
DQN65_RS07735 | 1694768..1696054 | - | 1287 | WP_039674781.1 | L-seryl-tRNA(Sec) selenium transferase | - |
DQN65_RS07745 | 1696206..1697180 | + | 975 | WP_039674779.1 | selenide, water dikinase SelD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10797.29 Da Isoelectric Point: 10.8344
>T292598 WP_082013920.1 NZ_LS483460:c1692700-1692419 [Corynebacterium minutissimum]
MIQSFANRDTELVWLRQASPRIDSRIHKTANRKLHQLDAAVSLQSLRVPPGNRLEALKGDRKGMYSIRVNQQWRITFRWT
EAGPADVAIEDYH
MIQSFANRDTELVWLRQASPRIDSRIHKTANRKLHQLDAAVSLQSLRVPPGNRLEALKGDRKGMYSIRVNQQWRITFRWT
EAGPADVAIEDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|