Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
| Location | 1752374..1753007 | Replicon | chromosome |
| Accession | NZ_LS483452 | ||
| Organism | Shewanella benthica strain DB21MT-2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | SHEWBE_RS08100 | Protein ID | WP_112352236.1 |
| Coordinates | 1752675..1753007 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | SHEWBE_RS08095 | Protein ID | WP_112352235.1 |
| Coordinates | 1752374..1752688 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SHEWBE_RS20005 | 1749572..1749736 | + | 165 | WP_172605666.1 | hypothetical protein | - |
| SHEWBE_RS08085 | 1749922..1751274 | - | 1353 | WP_112352233.1 | 8-oxoguanine deaminase | - |
| SHEWBE_RS08095 | 1752374..1752688 | - | 315 | WP_112352235.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| SHEWBE_RS08100 | 1752675..1753007 | - | 333 | WP_112352236.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| SHEWBE_RS08105 | 1753921..1754335 | + | 415 | Protein_1507 | tyrosine-type recombinase/integrase | - |
| SHEWBE_RS08110 | 1754332..1755451 | + | 1120 | Protein_1508 | IS91 family transposase | - |
| SHEWBE_RS08115 | 1755736..1755960 | - | 225 | WP_112352237.1 | hypothetical protein | - |
| SHEWBE_RS08120 | 1756306..1756581 | + | 276 | WP_112352238.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12918.89 Da Isoelectric Point: 10.0278
>T292594 WP_112352236.1 NZ_LS483452:c1753007-1752675 [Shewanella benthica]
MKCIFVESRIFEKFRDNYLSDEEFRLFQAELMSNPKQGDVIQGTGGLRKVRVASKGKGKRGGSRVIYYFLDEKRRCYLLT
IYGKSEMSDLTADQKKQLKAFMEVWRNEQS
MKCIFVESRIFEKFRDNYLSDEEFRLFQAELMSNPKQGDVIQGTGGLRKVRVASKGKGKRGGSRVIYYFLDEKRRCYLLT
IYGKSEMSDLTADQKKQLKAFMEVWRNEQS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|