Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 345049..345734 | Replicon | chromosome |
| Accession | NZ_LS483452 | ||
| Organism | Shewanella benthica strain DB21MT-2 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | - |
| Locus tag | SHEWBE_RS01695 | Protein ID | WP_112351150.1 |
| Coordinates | 345339..345734 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | - |
| Locus tag | SHEWBE_RS01690 | Protein ID | WP_112351148.1 |
| Coordinates | 345049..345342 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SHEWBE_RS01665 | 340742..341140 | + | 399 | WP_112351141.1 | ribosome-associated heat shock protein Hsp15 | - |
| SHEWBE_RS01670 | 341250..342113 | + | 864 | WP_112351142.1 | Hsp33 family molecular chaperone HslO | - |
| SHEWBE_RS01675 | 342640..344181 | + | 1542 | WP_112351144.1 | phosphoenolpyruvate carboxykinase | - |
| SHEWBE_RS01685 | 344645..344887 | + | 243 | WP_112351146.1 | helix-turn-helix transcriptional regulator | - |
| SHEWBE_RS01690 | 345049..345342 | + | 294 | WP_112351148.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| SHEWBE_RS01695 | 345339..345734 | + | 396 | WP_112351150.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
| SHEWBE_RS01700 | 346143..347990 | + | 1848 | WP_112351152.1 | M14 family metallopeptidase | - |
| SHEWBE_RS01705 | 348100..348399 | - | 300 | WP_112351154.1 | hypothetical protein | - |
| SHEWBE_RS01710 | 348396..348998 | - | 603 | WP_112351156.1 | TonB-dependent receptor | - |
| SHEWBE_RS01715 | 349012..349641 | - | 630 | WP_172605626.1 | TonB-dependent receptor plug domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 15069.18 Da Isoelectric Point: 6.6928
>T292593 WP_112351150.1 NZ_LS483452:345339-345734 [Shewanella benthica]
VTRVFKARPILDALTEAEQHQLVSDFKSYKEGELPELFGRDVLYDHPMNLAAIKDEEVRHLHLGNADAPWPIWKAQFNRT
SDKHLVYCCGDTHPDRYLLMAILTPSAHDKAKDNNVMSRLGTMAEKFKEIH
VTRVFKARPILDALTEAEQHQLVSDFKSYKEGELPELFGRDVLYDHPMNLAAIKDEEVRHLHLGNADAPWPIWKAQFNRT
SDKHLVYCCGDTHPDRYLLMAILTPSAHDKAKDNNVMSRLGTMAEKFKEIH
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|