Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 1651926..1652438 Replicon chromosome
Accession NZ_LS483451
Organism Streptococcus pneumoniae strain 4041STDY6836166

Toxin (Protein)


Gene name yoeB Uniprot ID Q8DNR3
Locus tag DQL01_RS08805 Protein ID WP_000924721.1
Coordinates 1651926..1652180 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID K0ZY22
Locus tag DQL01_RS08810 Protein ID WP_000388572.1
Coordinates 1652184..1652438 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL01_RS08770 1647007..1647321 - 315 WP_000979235.1 DNA-directed RNA polymerase subunit omega -
DQL01_RS08775 1647346..1647972 - 627 WP_000775037.1 guanylate kinase -
DQL01_RS08780 1648102..1649715 - 1614 WP_000404940.1 ribonuclease Y -
DQL01_RS08785 1649785..1650075 - 291 WP_000451507.1 recombinase family protein -
DQL01_RS08790 1650198..1650974 - 777 WP_111702672.1 hypothetical protein -
DQL01_RS12005 1650990..1651130 - 141 WP_168976882.1 hypothetical protein -
DQL01_RS08795 1651084..1651587 - 504 Protein_1657 KilA-N domain-containing protein -
DQL01_RS08805 1651926..1652180 - 255 WP_000924721.1 Txe/YoeB family addiction module toxin Toxin
DQL01_RS08810 1652184..1652438 - 255 WP_000388572.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DQL01_RS08815 1652675..1653772 - 1098 WP_111702673.1 nucleotidyltransferase -
DQL01_RS08820 1653782..1654591 - 810 WP_172449531.1 class I SAM-dependent methyltransferase -
DQL01_RS08825 1654686..1655039 - 354 WP_111702674.1 ribosome silencing factor -
DQL01_RS08830 1655052..1655552 - 501 WP_111702675.1 cysteine hydrolase -
DQL01_RS08835 1655553..1656146 - 594 WP_111702676.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK -
DQL01_RS08840 1656146..1656775 - 630 WP_111702677.1 nicotinate-nucleotide adenylyltransferase -
DQL01_RS08845 1656827..1657138 - 312 WP_000060171.1 ribosome assembly RNA-binding protein YhbY -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(1-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-75)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 10115.55 Da        Isoelectric Point: 7.9716

>T292591 WP_000924721.1 NZ_LS483451:c1652180-1651926 [Streptococcus pneumoniae]
MLLKFTEDAWADYCYWQNQDKKTLKRINKLIKDIQRDPFTGIGKPEPLKYDYQGAWSRRIDAENRLIYMMDGDSVAFLSF
KDHY

Download         Length: 255 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9706.00 Da        Isoelectric Point: 4.8430

>AT292591 WP_000388572.1 NZ_LS483451:c1652438-1652184 [Streptococcus pneumoniae]
MEAVLYSTFRNHLKDYMKKVNDEFEPLTVVNKNPDEDIVVLSKSEWDSIQETLRIAQNKELSDKVLRGMAQVRAGSTQVH
VIEE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0B7LEN4

Antitoxin

Source ID Structure
AlphaFold DB K0ZY22

References